Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Osteoclast-Associated Immunoglobulin-Like Receptor Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:OSCAR, Osteoclast-associated receptor, hOSCAR, Polymeric immunoglobulin receptor 3, PIgR-3, PIgR3, Poly-Ig receptor 3
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172463100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 221 AA. MW: 24.4 kDa (calculated). UniProtKB acc.no. Q8IYS5–2 Isoform 2 (Asp19-Asn229). N-terminal his-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASDITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEDSGSSDYTRGN

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 95%

SDS-PAGE Gel

14 % SDS-PAGE separation of Human Oscar (E.coli):
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. Reduced and boiled sample, 2.5 μg/lane
3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/μg

Formulation

0,3–0,6 mg/ml in 50mM acetate buffer, pH4.0, 20%(w/v) glycerol – filtered (0.4 μm), frozen

Reconstitution

Thaw at ambient temperature

Applications

Western blotting, ELISA

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Aliquot thawed protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Thawed protein should be used within one day to avoid forming of agragates.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Related Products Docs