Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Osteoprotegerin Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:OPG, Osteoclastogenesis inhibitory factor, OCIF, TNFRSF11B, Tumor Necrosis Factor Receptor Superfamily Member 11B
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10257010 10 µg
RBG10257050 50 µg
RBG10257100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Osteoprotegerin (OPG) is a member of the TNFR superfamily that can act as a decoy receptor for RANKL. Binding of soluble OPG to sRANKL inhibits osteoclastogenesis by interrupting the signaling between stromal cells and osteoclastic progenitor cells, thereby leading to excess accumulation of bone and cartilage. OPG is expressed in a wide variety of tissues, including the adult heart, lung, kidney, liver, spleen, prostate, lymph node, and bone marrow. OPG is secreted both as a monomeric and a dimeric protein. Its primary structure consists of seven distinct domains, four of which correspond to the extracellular cysteine-rich domains of TNFR proteins and constitute the soluble OPG. Recombinant Human OPG is a soluble 20.0 kDa protein containing 174 amino acid residues.

Amino Acid Sequence

METFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQK

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to neutralize the stimulation of U937 cells treated with 10 ng/ml of soluble RANKL (sRANKL).

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in 5mM Tris, pH 7.5 to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Bone and cartilage metabolism

Summary

Osteoprotegerin (OPG) or osteoclastogenesis inhibitory factor (OCIF) is a secretory glycoprotein belonging to TNF receptor superfamily. OPG consists of 401 amino acid residues, it has a molecular weight of 60 kDa as a monomer and 120 kDa as a disulfide-linked dimer and is produced in different tissues, e.g. bone, skin, liver, stomach, intestine and lung. Osteoprotegerin inhibits the recruitment, proliferation and activation of osteoclasts. Osteoclast formation activity may be monitored principally by determination of concentration ratio of osteoprotegerin ligand (OPGL)/OPG. Alteration of this ratio may be the cause of bone loss in many imbalances in bone metabolism such as osteoporosis, osteopetrosis, hypercalcemia, metastatic osteolytic lesions and rheumatic bone degradation.

Summary References (17)

References to Osteoprotegerin

  • Asanuma YF, Shimada Y, Kouzu N, Yokota K, Nakajima K, Sato K, Akiyama Y, Isozaki M, Mikami AS, Kobayashi H, Mimura T. Serum osteoprotegerin concentration is associated with carotid atherosclerotic plaque in patients with rheumatoid arthritis. Mod Rheumatol. 2012 May 15;
  • Aubin JE, Bonnelye E. Osteoprotegerin and its ligand: A new paradigm for regulation of osteoclastogenesis and bone resorption. Medscape Womens Health. 2000 Mar;5 (2):5
  • Avignon A, Sultan A, Piot C, Mariano-Goulart D, Thuan Dit Dieudonne JF, Cristol JP, Dupuy AM. Osteoprotegerin: a novel independent marker for silent myocardial ischemia in asymptomatic diabetic patients. Diabetes Care. 2007 Nov;30 (11):2934-9
  • Bai P, Sun Y, Jin J, Hou J, Li R, Zhang Q, Wang Y. Disturbance of the OPG/RANK/RANKL pathway and systemic inflammation in COPD patients with emphysema and osteoporosis. Respir Res. 2011;12:157
  • Bucay N, Sarosi I, Dunstan CR, Morony S, Tarpley J, Capparelli C, Scully S, Tan HL, Xu W, Lacey DL, Boyle WJ, Simonet WS. osteoprotegerin-deficient mice develop early onset osteoporosis and arterial calcification. Genes Dev. 1998 May 1;12 (9):1260-8
  • Feuerherm AJ, Borset M, Seidel C, Sundan A, Leistad L, Ostensen M, Faxvaag A. Elevated levels of osteoprotegerin (OPG) and hepatocyte growth factor (HGF) in rheumatoid arthritis. Scand J Rheumatol. 2001;30 (4):229-34
  • Golledge J, McCann M, Mangan S, Lam A, Karan M. Osteoprotegerin and osteopontin are expressed at high concentrations within symptomatic carotid atherosclerosis. Stroke. 2004 Jul;35 (7):1636-41
  • Gurban CV, Mederle O. The OPG/RANKL system and zinc ions are promoters of bone remodeling by osteoblast proliferation in postmenopausal osteoporosis. Rom J Morphol Embryol. 2011;52 (3 Suppl):1113-9
  • Hofbauer LC. Osteoprotegerin ligand and osteoprotegerin: novel implications for osteoclast biology and bone metabolism. Eur J Endocrinol. 1999 Sep;141 (3):195-210
  • Kerschan-Schindl K, Mitterbauer M, Fureder W, Kudlacek S, Grampp S, Bieglmayer C, Fialka-Moser V, Pietschmann P, Kalhs P. Bone metabolism in patients more than five years after bone marrow transplantation. Bone Marrow Transplant. 2004 Sep;34 (6):491-6
  • Lien G, Ueland T, Godang K, Selvaag AM, Forre OT, Flato B. Serum levels of osteoprotegerin and receptor activator of nuclear factor -kappaB ligand in children with early juvenile idiopathic arthritis: a 2-year prospective controlled study. Pediatr Rheumatol Online J. 2010;8:30
  • Moran CS, McCann M, Karan M, Norman P, Ketheesan N, Golledge J. Association of osteoprotegerin with human abdominal aortic aneurysm progression. Circulation. 2005 Jun 14;111 (23):3119-25
  • Morse LR, Nguyen HP, Jain N, Williams S, Tun CG, Battaglino RA, Stashenko P, Garshick E. Age and motor score predict osteoprotegerin level in chronic spinal cord injury. J Musculoskelet Neuronal Inter. 2008 Jan-Mar;8 (1):50-7
  • Nellemann B, Gormsen LC, Dollerup J, Schmitz O, Mogensen CE, Rasmussen LM, Nielsen S. Simvastatin reduces plasma osteoprotegerin in type 2 diabetic patients with microalbuminuria. Diabetes Care. 2007 Dec;30 (12):3122-4
  • Roysland R, Bonaca MP, Omland T, Sabatine M, Murphy SA, Scirica BM, Bjerre M, Flyvbjerg A, Braunwald E, Morrow DA. Osteoprotegerin and cardiovascular mortality in patients with non-ST elevation acute coronary syndromes. Heart. 2012 May;98 (10):786-91
  • Secchiero P, Corallini F, Pandolfi A, Consoli A, Candido R, Fabris B, Celeghini C, Capitani S, Zauli G. An increased osteoprotegerin serum release characterizes the early onset of diabetes mellitus and may contribute to endothelial cell dysfunction. Am J Pathol. 2006 Dec;169 (6):2236-44
  • Simonet WS, Lacey DL, Dunstan CR, Kelley M, Chang MS, Luthy R, Nguyen HQ, Wooden S, Bennett L, Boone T, Shimamoto G, DeRose M, Elliott R, Colombero A, Tan HL, Trail G, Sullivan J, Davy E, Bucay N, Renshaw-Gegg L, Hughes TM, Hill D, Pattison W, Campbell P, Sander S, Van G, Tarpley J, Derby P, Lee R, Boyle WJ. Osteoprotegerin: a novel secreted protein i
Related Products Docs