Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

OTOR Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Otoraplin, MIAL
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10258005 5 µg
RBG10258020 20 µg
RBG10258100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

OTOR, also called Otoraplin and MIAL, is a secreted cytokine of the MIA/OTOR family. Members of this family, which include MIA, MIA2, and TANGO, share a Src homology-3 (SH3)-like domain. OTOR is predominantly expressed in the cochlea of the inner ear, and, to a lesser extent, in fetal brain tissue and some cartilage tissues. OTOR appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function. Recombinant Human OTOR is a 12.7 kDa globular protein containing 112 amino acid residues.

Amino Acid Sequence

MVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE

Source

E. coli

Purity

98%

Biological Activity

Data Not Available.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules

Related Products Docs