Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Oxidized low-density lipoprotein receptor 1 Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293
  • Other names:Ox-LDL receptor 1, C-type lectin domain family 8 member A, Lectin-like oxidized LDL receptor 1, LOX-1, Lectin-like oxLDL receptor 1, hLOX-1, Lectin-type oxidized LDL receptor 1, OLR1, CLEC8A, SCARE1, SR-E1, LOX1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172143100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 221 AA. MW: 25.3 kDa (calculated). UniProtKB acc. No. P78380 (Ser61–Gln273). N-terminal flag-tag (8 AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

DYKDDDDKSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

Source

HEK293

Purity

Purity as determined by densitometric image analysis: > 95 %

SDS-PAGE Gel

12 % SDS-PAGE separation of Human sLOX1 (Flag tag):
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. Reduced and boiled sample, 2.5 μg/lane
3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/μg

Formulation

Filtered (0.4 μm) and lyophilized from phosphate buffered saline pH 7.5.

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA, Cell culture and/or animal studies

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Related Products Docs