Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

PDGF-BB Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Platelet-Derived Growth Factor-BB,Platelet-derived growth factor subunit B, PDGF-2, PDGF beta polypeptide, Proto-oncogene c-Sis, Becaplermin, PDGFB, PDGF2, SIS
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20109002 2 µg
RBG20109010 10 µg
RBG20109100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

PDGFs are disulfide-linked dimers consisting of two 12.0–13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs, PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types, including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet α-granules, and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-α and PDGFR-β. PDGFR-α is a high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-β interacts with only PDGF-BB and PDGF-AB. Recombinant Murine PDGF-BB is a 24.4 kDa disulfide-linked homodimer of two β chains (218 total amino acids).

Amino Acid Sequence

MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT

Source

E. coli

Purity

98%

Biological Activity

Determined by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells. The expected ED50 for this effect is 1.0–2.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Bone and cartilage metabolism, Cardiovascular disease, Coronary artery disease, Immune Response, Infection and Inflammation, Neural tissue markers, Oncology, Animal studies

Related Products Docs