Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

PF-4 Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Platelet Factor-4, CXCL4, Oncostatin A, Ironplact
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20111005 5 µg
RBG20111020 20 µg
RBG20111100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

PF-4 is a CXC chemokine that is expressed in megakaryocytes and stored in the α-granules of platelets. PF-4 is chemotactic towards neutrophils and monocytes, and has been shown to inhibit angiogenesis. Recombinant Murine PF-4 is an 8.2 kDa protein containing 76 amino acid residues, including the four highly conserved residues present in CXC chemokines.

Amino Acid Sequence

VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human neutrophils using a concentration range of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Chemokines, Coronary artery disease, Cytokines and chemokines and related molecules, Animal studies

Related Products Docs