Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Placental Protein 13 (Galectin-13) Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Galactoside-Binding Soluble Lectin 13, Galectin-13, Gal-13, Placental tissue protein 13, PP13, LGALS13, PLAC8
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172254100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 149 AA. MW: 17.36 kDa (calculated). UniProtKB acc.no. Q9UHV8. N-Terminal His-tag (10 extra AA)

Amino Acid Sequence

MKHHHHHHASMSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN

Source

E. coli

Purity

>90%

SDS-PAGE Gel

14% SDS-PAGE separation of Human PP13
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 5μg/lane
3. non-reduced and non-boiled sample, 5μg/lane

Endotoxin

< 1.0 EU/μg

Formulation

Filtered (0.4 μm) and lyophilized in phosphate buffered saline pH 7.5.

Reconstitution

Add deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA, Immunoassays

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Summary

Research topic

Reproduction

Summary

Placental protein 13 (PP13, Galectin 13) is the member of the beta-galactoside binding S-type galectin superfamily, whose members are important in placenta implantation and remodelling of maternal arteries. PP13 binds to beta-galactoside residues of several proteins on the cell surface, cytoskeleton and extracellular matrix, thereby generating various responses such as immune responses and influencing other functions like apoptosis and molecular recognition. PP13, which is predominantly produced by placental tissue, possesses a conserved carbohydrate binding domain, to which two proteins Annexin-II and Actin-beta bind. These proteins are considered to play a key role in placentation and maternal artery remodelling respectively. Human PP13 is a relatively small protein with 139 amino acids and is composed of two identical 16 kDa subunits held together by disulfide bonds. PP13 was first isolated from placenta and especially from the syncytiotrophoblast in 1983 by Bohn et. al. It is localized to the syncytiotrophoblast brush border membrane, and detected in maternal and cord blood. Though it is found primarily in placenta, some PP13 expression was also detected in healthy spleen, kidney and bladder tissue and in liver adenocarcinoma, neurogen tumour and malignant melanoma. The serum levels of PP13 slowly increase during a normal pregnancy but abnormally low levels of PP-13 were detected in first trimester serum samples of women subsequently developing fetal growth restriction and preeclampsia, especially in cases with early onset. Elevated serum concentrations of PP-13 have been found in the second and third trimester in women with preeclampsia, intrauterine growth restriction (IUGR) and in preterm delivery. Another study concluded that first-trimester serum levels of PP13 may serve as a suitable marker for preterm preeclampsia but are weak for the prediction of severe preeclampsia and ineffective for mild preeclampsia at term.

Summary References (10)

References to Placental Protein 13

  • Balogh A, Pozsgay J, Matko J, Dong Z, Kim CJ, Varkonyi T, Sammar M, Rigo J Jr, Meiri H, Romero R, Papp Z, Than NG. Placental protein 13 (PP13/galectin-13) undergoes lipid raft-associated subcellular redistribution in the syncytiotrophoblast in preterm preeclampsia and HELLP syndrome. Am J Obstet Gynecol. 2011 Aug;205 (2):156.e1-14
  • Bohn H, Kraus W, Winckler W. Purification and characterization of two new soluble placental tissue proteins (PP13 and PP17). Oncodev Biol Med. 1983;4 (5):343-50
  • Carty DM, Delles C, Dominiczak AF. Novel biomarkers for predicting preeclampsia. Trends Cardiovasc Med. 2008 Jul;18 (5):186-94
  • Grill S, Rusterholz C, Zanetti-Dallenbach R, Tercanli S, Holzgreve W, Hahn S, Lapaire O. Potential markers of preeclampsia--a review. Reprod Biol Endocrinol. 2009;7:70
  • Huppertz B, Meiri H, Gizurarson S, Osol G, Sammar M. Placental protein 13 (PP13): a new biological target shifting individualized risk assessment to personalized drug design combating pre-eclampsia. Hum Reprod Update. 2013 Jul-Aug;19 (4):391-405
  • Nicolaides KH, Bindra R, Turan OM, Chefetz I, Sammar M, Meiri H, Tal J, Cuckle HS. A novel approach to first-trimester screening for early pre-eclampsia combining serum PP-13 and Doppler ultrasound. Ultrasound Obstet Gynecol. 2006 Jan;27 (1):13-7
  • Orendi K, Gauster M, Moser G, Meiri H, Huppertz B. Effects of vitamins C and E, acetylsalicylic acid and heparin on fusion, beta-hCG and PP13 expression in BeWo cells. Placenta. 2010 May;31 (5):431-8
  • Petla LT, Chikkala R, Ratnakar KS, Kodati V, Sritharan V. Biomarkers for the management of pre-eclampsia in pregnant women. Indian J Med Res. 2013;138:60-7
  • Than NG, Abdul Rahman O, Magenheim R, Nagy B, Fule T, Hargitai B, Sammar M, Hupuczi P, Tarca AL, Szabo G, Kovalszky I, Meiri H, Sziller I, Rigo J Jr, Romero R, Papp Z. Placental protein 13 (galectin-13) has decreased placental expression but increased shedding and maternal serum concentrations in patients presenting with preterm pre-eclampsia and HELLP syndrome. Virchows Arch. 2008 Oct;453 (4):387-400
  • Visegrady B, Than NG, Kilar F, Sumegi B, Than GN, Bohn H. Homology modelling and molecular dynamics studies of human placental tissue protein 13 (galectin-13). Protein Eng. 2001 Nov;14 (11):875-80
Related Products Docs