Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

PLGF-1 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Placenta Growth Factor-1, PIGF, PGF
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10274005 5 µg
RBG10274025 25 µg
RBG10274100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

PlGF-1 is an angiogenic factor that belongs to the cysteine-knot superfamily of growth factors. PlGF-1 is expressed in placental tissues, the colon, and mammary carcinomas. It signals through the VEGFR-1/FLT1 receptor, and stimulates endothelial cell proliferation and migration. Recombinant Human PlGF-1 is a 29.7 kDa disulfide-linked homodimeric protein of two 132 amino acid polypeptide chains.

Amino Acid Sequence

MLPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR

Source

E. coli

Purity

95%

Biological Activity

Determined by its ability to chemoattract human monocytes of using a concentration range of 1.0–10.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease, Oncology

Related Products Docs