Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

Procathepsin K Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CTSK
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RD172074100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 326 AA. MW: 36.7 kDa (calculated). UniProtKB acc. no. P43235 (Leu16-Met114). N-terminal His-tag (12 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MRGSHHHHHHGSLYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Source

E. coli

Purity

Purity as determined by densitometric image analysis: >95%

Endotoxin

< 0.1 EU/μg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in 30 mM acetate buffer, pH 4.

Reconstitution

Add 0.1 M acetate buffer pH 4.0 to prepare a working stock solution of 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.