United States set
language
Menu Shopping cart $0 Search
Advanced Search
You are here:   Home Products and Services Antibodies Adiponectin (HEK) Human, Sheep Polyclonal Antibody
Manufactured by BioVendor

Adiponectin (HEK) Human, Sheep Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:Adipocyte C1q and collagen domain-containing protein, Adipocyte complement-related 30 kDa protein, ACRP30, Adipose most abundant gene transcript 1 protein, apM-1, Gelatin-binding protein, ADIPOQ, ACDC, APM1, GBP28
  • Species:Human
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs

RD184023100-01 0.1 mg $277 / $243 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA, Immunohistochemistry

Antibodies Applications

Source of Antigen

HEK293

Hosts

Sheep

Preparation

The antibody was raised in sheep by immunization with the recombinant Human Adiponectin.

Amino Acid Sequence

Recombinant Human Adiponectin, total 234 AA. MW 25.5 kDa (calculated). UniProtKB acc.no. Q15848 (Glu19 – Asn244). C-Terminal flag tag (8 extra AA).

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNDYKDDDDK

Glu 1 to Gln 5 were confirmed by N-terminal sequencing

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human Adiponectin.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. 

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Chronic renal failure, Coronary artery disease, Diabetology - Other Relevant Products, Energy metabolism and body weight regulation

Summary

Adiponectin, also referred to as Acrp30, AdipoQ and GBP-28, is a recently discovered 244 aminoacid protein, the product of the apM1 gene, which is physiologically active and specifically and highly expressed in adipose cells. The protein belongs to the soluble defence collagen superfamily; it has a collagen-like domain structurally homologous with collagen VIII and X and complement factor C1q-like globular domain. Adiponectin forms homotrimers, which are the building blocks for higher order complexes found circulating in serum. Together, these complexes make up approximately 0.01% of total serum protein. Adiponectin receptors AdipoR1 and AdipoR2 have been recently cloned; AdipoR1 is abundantly expressed in skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver. Paradoxically, adipose tissue-expressed adiponectin levels are inversely related to the degree of adiposity. Adiponectin concentrations correlate negatively with glucose, insulin, triglyceride concentrations, liver fat content and body mass index and positively with high-density lipoprotein-cholesterol levels, hepatic insulin sensitivity and insulin-stimulated glucose disposal. Adiponectin has been shown to increase insulin sensitivity and decrease plasma glucose by increasing tissue fat oxidation. Of particular interest is that low adiponectin serum levels predict type 2 diabetes independent of other risk factors. Adiponectin also inhibits the inflammatory processes of atherosclerosis suppressing the expression of adhesion and cytokine molecules in vascular endothelial cells and macrophages, respectively. This adipokine plays a role as a scaffold of newly formed collagen in myocardial remodelling after ischaemic injury and also stimulates angiogenesis by promoting cross-talk between AMP-activated protein kinase and Akt signalling in endothelial cells. Low serum adiponectin levels are found in patients with coronary artery disease. Moreover, high circulating levels of adiponectin are associated with decreased risk of myocardial infarction, independent of other factors. Altogether, adiponectin has the potential to become a clinically relevant parameter to be measured routinely in subjects at risk for type 2 diabetes, atherosclerosis and the metabolic syndrome.

Product References (70)

References

  • Glintborg D, Frystyk J, Højlund K, Andersen KK, Henriksen JE, Hermann AP, Hagen C, Flyvbjerg A, Andersen M. Total and high molecular weight (HMW) adiponectin levels and measures of glucose and lipid metabolism following pioglitazone treatment in a randomized placebo-controlled study in polycystic ovary syndrome. Clin Endocrinol (Oxf). 2008 Feb;68(2):165-74. doi: 10.1111/j.1365-2265.2007.03015.x. Epub 2007 Sep 4. PubMed PMID: 17803698. See more on PubMed
  • Haqq AM, Muehlbauer M, Svetkey LP, Newgard CB, Purnell JQ, Grambow SC, Freemark MS. Altered distribution of adiponectin isoforms in children with Prader-Willi syndrome (PWS): association with insulin sensitivity and circulating satiety peptide hormones. Clin Endocrinol (Oxf). 2007 Dec;67(6):944-51. doi: 10.1111/j.1365-2265.2007.02991.x. Epub 2007 Jul 30. PubMed PMID: 17666087. PubMed CentralPMCID: PMC2605973. See more on PubMed
  • Odden N, Mørkrid L. High molecular weight adiponectin dominates in cord blood of newborns but is unaffected by pre-eclamptic pregnancies. Clin Endocrinol (Oxf). 2007 Dec;67(6):891-6. doi: 10.1111/j.1365-2265.2007.02981.x. Epub 2007 Jul 30. PubMed PMID: 17666092. See more on PubMed
  • von Eynatten M, Humpert PM, Bluemm A, Lepper PM, Hamann A, Allolio B, Nawroth PP, Bierhaus A, Dugi KA. High-molecular weight adiponectin is independently associated with the extent of coronary artery disease in men. Atherosclerosis. 2008 Jul;199(1):123-8. doi: 10.1016/j.atherosclerosis.2007.10.002. Epub 2007 Nov 19. PubMed PMID: 18021784. See more on PubMed
  • Schraw T, Wang ZV, Halberg N, Hawkins M, Scherer PE. Plasma adiponectin complexes have distinct biochemical characteristics. Endocrinology. 2008 May;149(5):2270-82. doi: 10.1210/en.2007-1561. Epub 2008 Jan 17. PubMed PMID: 18202126. PubMed CentralPMCID: PMC2329278. See more on PubMed
  • Westphal S, Luley C. Preferential increase in high-molecular weight adiponectin after niacin. Atherosclerosis. 2008 May;198(1):179-83. doi: 10.1016/j.atherosclerosis.2007.09.036. Epub 2007 Nov 8. PubMed PMID: 17996241. See more on PubMed
  • Nakatani H, Hirose H, Yamamoto Y, Saito I, Itoh H. Significance of leptin and high-molecular weight adiponectin in the general population of Japanese male adolescents. Metabolism. 2008 Feb;57(2):157-62. doi: 10.1016/j.metabol.2007.08.019. PubMed PMID: 18191043. See more on PubMed
  • Adachi M, Brenner DA. High molecular weight adiponectin inhibits proliferation of hepatic stellate cells via activation of adenosine monophosphate-activated protein kinase. Hepatology. 2008 Feb;47(2):677-85. doi: 10.1002/hep.21991. PubMed PMID: 18220291. See more on PubMed
  • Sinha MK, Songer T, Xiao Q, Sloan JH, Wang J, Ji S, Alborn WE, Davis RA, Swarbrick MM, Stanhope KL, Wolfe BM, Havel PJ, Schraw T, Konrad RJ, Scherer PE, Mistry JS. Analytical validation and biological evaluation of a high molecular-weight adiponectin ELISA. Clin Chem. 2007 Dec;53(12):2144-51. doi: 10.1373/clinchem.2007.090670. Epub 2007 Oct 19. PubMed PMID: 17951289. See more on PubMed
  • Komura N, Kihara S, Sonoda M, Kumada M, Fujita K, Hiuge A, Okada T, Nakagawa Y, Tamba S, Kuroda Y, Hayashi N, Sumitsuji S, Kawamoto T, Matsumoto S, Ouchi N, Arita Y, Okamoto Y, Shimomura I, Funahashi T, Matsuzawa Y. Clinical significance of high-molecular weight form of adiponectin in male patients with coronary artery disease. Circ J. 2008 Jan;72(1):23-8. doi: 10.1253/circj.72.23. PubMed PMID: 18159094. See more on PubMed
  • Tsutamoto T, Tanaka T, Sakai H, Ishikawa C, Fujii M, Yamamoto T, Horie M. Total and high molecular weight adiponectin, haemodynamics, and mortality in patients with chronic heart failure. Eur Heart J. 2007 Jul;28(14):1723-30. doi: 10.1093/eurheartj/ehm154. Epub 2007 May 15. PubMed PMID: 17507366. See more on PubMed
  • Torigoe M, Matsui H, Ogawa Y, Murakami H, Murakami R, Cheng XW, Numaguchi Y, Murohara T, Okumura K. Impact of the high-molecular-weight form of adiponectin on endothelial function in healthy young men. Clin Endocrinol (Oxf). 2007 Aug;67(2):276-81. doi: 10.1111/j.1365-2265.2007.02876.x. Epub 2007 Jun 4. PubMed PMID: 17547685. See more on PubMed
  • Asada K, Yoshiji H, Noguchi R, Ikenaka Y, Kitade M, Kaji K, Yoshii J, Yanase K, Namisaki T, Yamazaki M, Tsujimoto T, Akahane T, Uemura M, Fukui H. Crosstalk between high-molecular-weight adiponectin and T-cadherin during liver fibrosis development in rats. Int J Mol Med. 2007 Nov;20(5):725-9. PubMed PMID: 17912467. See more on PubMed
  • Liu Y, Retnakaran R, Hanley A, Tungtrongchitr R, Shaw C, Sweeney G. Total and high molecular weight but not trimeric or hexameric forms of adiponectin correlate with markers of the metabolic syndrome and liver injury in Thai subjects. J Clin Endocrinol Metab. 2007 Nov;92(11):4313-8. doi: 10.1210/jc.2007-0890. Epub 2007 Aug 14. PubMed PMID: 17698903. See more on PubMed
  • Seino Y, Hirose H, Saito I, Itoh H. High molecular weight multimer form of adiponectin as a useful marker to evaluate insulin resistance and metabolic syndrome in Japanese men. Metabolism. 2007 Nov;56(11):1493-9. doi: 10.1016/j.metabol.2007.06.015. PubMed PMID: 17950099. See more on PubMed
  • Nishimura R, Morimoto A, Matsudaira T, Miyashita Y, Sano H, Shirasawa T, Takahashi E, Tajima N. Ratio of high-, medium-, and low-molecular weight serum adiponectin to the total adiponectin value in children. J Pediatr. 2007 Nov;151(5):545-7, 547.e1-2. doi: 10.1016/j.jpeds.2007.07.047. PubMed PMID: 17961704. See more on PubMed
  • Ong GK, Hamilton JK, Sermer M, Connelly PW, Maguire G, Zinman B, Hanley AJ, Retnakaran R. Maternal serum adiponectin and infant birthweight: the role of adiponectin isoform distribution. Clin Endocrinol (Oxf). 2007 Jul;67(1):108-14. doi: 10.1111/j.1365-2265.2007.02846.x. Epub 2007 Apr 27. PubMed PMID: 17466005. See more on PubMed
  • Beulens JW, van Loon LJ, Kok FJ, Pelsers M, Bobbert T, Spranger J, Helander A, Hendriks HF. The effect of moderate alcohol consumption on adiponectin oligomers and muscle oxidative capacity: a human intervention study. Diabetologia. 2007 Jul;50(7):1388-92. doi: 10.1007/s00125-007-0699-8. Epub 2007 May 11. PubMed PMID: 17492425. PubMed CentralPMCID: PMC1914282. See more on PubMed
  • Schober F, Neumeier M, Weigert J, Wurm S, Wanninger J, Schäffler A, Dada A, Liebisch G, Schmitz G, Aslanidis C, Buechler C. Low molecular weight adiponectin negatively correlates with the waist circumference and monocytic IL-6 release. Biochem Biophys Res Commun. 2007 Oct 5;361(4):968-73. doi: 10.1016/j.bbrc.2007.07.106. Epub 2007 Jul 30. PubMed PMID: 17678873. See more on PubMed
  • Hui CK, Zhang HY, Lee NP, Chan W, Yueng YH, Leung KW, Lu L, Leung N, Lo CM, Fan ST, Luk JM, Xu A, Lam KS, Kwong YL, Lau GK. Serum adiponectin is increased in advancing liver fibrosis and declines with reduction in fibrosis in chronic hepatitis B. J Hepatol. 2007 Aug;47(2):191-202. doi: 10.1016/j.jhep.2007.02.023. Epub 2007 Apr 12. PubMed PMID: 17462782. See more on PubMed
  • Oki K, Koide J, Nakanishi S, Nakashima R, Yamane K. Fenofibrate increases high molecular weight adiponectin in subjects with hypertriglyceridemia. Endocr J. 2007 Jun;54(3):431-5. doi: 10.1507/endocrj.k06-172. Epub 2007 Apr 25. PubMed PMID: 17457016. See more on PubMed
  • Kusminski CM, McTernan PG, Schraw T, Kos K, O'Hare JP, Ahima R, Kumar S, Scherer PE. Adiponectin complexes in human cerebrospinal fluid: distinct complex distribution from serum. Diabetologia. 2007 Mar;50(3):634-42. doi: 10.1007/s00125-006-0577-9. Epub 2007 Jan 23. PubMed PMID: 17242917. See more on PubMed
  • Petersen KF, Dufour S, Savage DB, Bilz S, Solomon G, Yonemitsu S, Cline GW, Befroy D, Zemany L, Kahn BB, Papademetris X, Rothman DL, Shulman GI. The role of skeletal muscle insulin resistance in the pathogenesis of the metabolic syndrome. Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12587-94. doi: 10.1073/pnas.0705408104. Epub 2007 Jul 18. PubMed PMID: 17640906. PubMed CentralPMCID: PMC1924794. See more on PubMed
  • Peake PW, Hughes JT, Shen Y, Charlesworth JA. Glycosylation of human adiponectin affects its conformation and stability. J Mol Endocrinol. 2007 Jul;39(1):45-52. doi: 10.1677/JME-07-0030. PubMed PMID: 17601884. See more on PubMed
  • Lo J, Bernstein LE, Canavan B, Torriani M, Jackson MB, Ahima RS, Grinspoon SK. Effects of TNF-alpha neutralization on adipocytokines and skeletal muscle adiposity in the metabolic syndrome. Am J Physiol Endocrinol Metab. 2007 Jul;293(1):E102-9. doi: 10.1152/ajpendo.00089.2007. Epub 2007 Mar 20. PubMed PMID: 17374698. PubMed CentralPMCID: PMC3196534. See more on PubMed
  • Basu R, Pajvani UB, Rizza RA, Scherer PE. Selective downregulation of the high molecular weight form of adiponectin in hyperinsulinemia and in type 2 diabetes: differential regulation from nondiabetic subjects. Diabetes. 2007 Aug;56(8):2174-7. doi: 10.2337/db07-0185. Epub 2007 May 18. PubMed PMID: 17513700. See more on PubMed
  • Retnakaran R, Connelly PW, Maguire G, Sermer M, Zinman B, Hanley AJ. Decreased high-molecular-weight adiponectin in gestational diabetes: implications for the pathophysiology of Type 2 diabetes. Diabet Med. 2007 Mar;24(3):245-52. doi: 10.1111/j.1464-5491.2007.02077.x. PubMed PMID: 17305786. See more on PubMed
  • Swarbrick MM, Austrheim-Smith IT, Stanhope KL, Van Loan MD, Ali MR, Wolfe BM, Havel PJ. Circulating concentrations of high-molecular-weight adiponectin are increased following Roux-en-Y gastric bypass surgery. Diabetologia. 2006 Nov;49(11):2552-8. doi: 10.1007/s00125-006-0452-8. Epub 2006 Sep 21. PubMed PMID: 17019599. See more on PubMed
  • Shen YY, Charlesworth JA, Kelly JJ, Loi KW, Peake PW. Up-regulation of adiponectin, its isoforms and receptors in end-stage kidney disease. Nephrol Dial Transplant. 2007 Jan;22(1):171-8. doi: 10.1093/ndt/gfl552. Epub 2006 Sep 27. PubMed PMID: 17005524. See more on PubMed
  • Blüher M, Brennan AM, Kelesidis T, Kratzsch J, Fasshauer M, Kralisch S, Williams CJ, Mantzoros CS. Total and high-molecular weight adiponectin in relation to metabolic variables at baseline and in response to an exercise treatment program: comparative evaluation of three assays. Diabetes Care. 2007 Feb;30(2):280-5. doi: 10.2337/dc06-1362. PubMed PMID: 17259495. See more on PubMed
  • Semple RK, Halberg NH, Burling K, Soos MA, Schraw T, Luan J, Cochran EK, Dunger DB, Wareham NJ, Scherer PE, Gorden P, O'Rahilly S. Paradoxical elevation of high-molecular weight adiponectin in acquired extreme insulin resistance due to insulin receptor antibodies. Diabetes. 2007 Jun;56(6):1712-7. doi: 10.2337/db06-1665. Epub 2007 Feb 26. PubMed PMID: 17325257. PubMed CentralPMCID: PMC2253187. See more on PubMed
  • Andersen KK, Frystyk J, Wolthers OD, Heuck C, Flyvbjerg A. Gender differences of oligomers and total adiponectin during puberty: a cross-sectional study of 859 Danish school children. J Clin Endocrinol Metab. 2007 May;92(5):1857-62. doi: 10.1210/jc.2006-2310. Epub 2007 Feb 6. PubMed PMID: 17284625. See more on PubMed
  • Modan-Moses D, Stein D, Pariente C, Yaroslavsky A, Ram A, Faigin M, Loewenthal R, Yissachar E, Hemi R, Kanety H. Modulation of adiponectin and leptin during refeeding of female anorexia nervosa patients. J Clin Endocrinol Metab. 2007 May;92(5):1843-7. doi: 10.1210/jc.2006-1683. Epub 2007 Feb 27. PubMed PMID: 17327386. See more on PubMed
  • Hattori Y, Hattori S, Akimoto K, Nishikimi T, Suzuki K, Matsuoka H, Kasai K. Globular adiponectin activates nuclear factor-kappaB and activating protein-1 and enhances angiotensin II-induced proliferation in cardiac fibroblasts. Diabetes. 2007 Mar;56(3):804-8. doi: 10.2337/db06-1405. PubMed PMID: 17327451. See more on PubMed
  • Suzuki S, Wilson-Kubalek EM, Wert D, Tsao TS, Lee DH. The oligomeric structure of high molecular weight adiponectin. FEBS Lett. 2007 Mar 6;581(5):809-14. doi: 10.1016/j.febslet.2007.01.046. Epub 2007 Jan 30. PubMed PMID: 17292892. PubMed CentralPMCID: PMC1865574. See more on PubMed
  • Takemura Y, Osuga Y, Koga K, Tajima T, Hirota Y, Hirata T, Morimoto C, Harada M, Yano T, Taketani Y. Selective increase in high molecular weight adiponectin concentration in serum of women with preeclampsia. J Reprod Immunol. 2007 Feb;73(1):60-5. doi: 10.1016/j.jri.2006.05.004. Epub 2006 Jul 24. PubMed PMID: 16860876. See more on PubMed
  • Neumeier M, Sigruener A, Eggenhofer E, Weigert J, Weiss TS, Schaeffler A, Schlitt HJ, Aslanidis C, Piso P, Langmann T, Schmitz G, Schölmerich J, Buechler C. High molecular weight adiponectin reduces apolipoprotein B and E release in human hepatocytes. Biochem Biophys Res Commun. 2007 Jan 12;352(2):543-8. doi: 10.1016/j.bbrc.2006.11.058. Epub 2006 Nov 20. PubMed PMID: 17129575. See more on PubMed
  • Iwashima Y, Horio T, Kumada M, Suzuki Y, Kihara S, Rakugi H, Kawano Y, Funahashi T, Ogihara T. Adiponectin and renal function, and implication as a risk of cardiovascular disease. Am J Cardiol. 2006 Dec 15;98(12):1603-8. doi: 10.1016/j.amjcard.2006.07.039. Epub 2006 Oct 18. PubMed PMID: 17145218. See more on PubMed
  • Araki S, Dobashi K, Kubo K, Asayama K, Shirahata A. High molecular weight, rather than total, adiponectin levels better reflect metabolic abnormalities associated with childhood obesity. J Clin Endocrinol Metab. 2006 Dec;91(12):5113-6. doi: 10.1210/jc.2006-1051. Epub 2006 Sep 19. PubMed PMID: 16984991. See more on PubMed
  • Salani B, Briatore L, Andraghetti G, Adami GF, Maggi D, Cordera R. High-molecular weight adiponectin isoforms increase after biliopancreatic diversion in obese subjects. Obesity (Silver Spring). 2006 Sep;14(9):1511-4. doi: 10.1038/oby.2006.174. PubMed PMID: 17030961. See more on PubMed
  • Ebinuma H, Miyazaki O, Yago H, Hara K, Yamauchi T, Kadowaki T. A novel ELISA system for selective measurement of human adiponectin multimers by using proteases. Clin Chim Acta. 2006 Oct;372(1-2):47-53. doi: 10.1016/j.cca.2006.03.014. Epub 2006 May 12. PubMed PMID: 16697359. See more on PubMed
  • Bodles AM, Banga A, Rasouli N, Ono F, Kern PA, Owens RJ. Pioglitazone increases secretion of high-molecular-weight adiponectin from adipocytes. Am J Physiol Endocrinol Metab. 2006 Nov;291(5):E1100-5. doi: 10.1152/ajpendo.00187.2006. Epub 2006 Jun 27. PubMed PMID: 16803857. See more on PubMed
  • Hara K, Horikoshi M, Yamauchi T, Yago H, Miyazaki O, Ebinuma H, Imai Y, Nagai R, Kadowaki T. Measurement of the high-molecular weight form of adiponectin in plasma is useful for the prediction of insulin resistance and metabolic syndrome. Diabetes Care. 2006 Jun;29(6):1357-62. doi: 10.2337/dc05-1801. PubMed PMID: 16732021. See more on PubMed
  • Chen TH, Chen L, Hsieh MS, Chang CP, Chou DT, Tsai SH. Evidence for a protective role for adiponectin in osteoarthritis. Biochim Biophys Acta. 2006 Aug;1762(8):711-8. doi: 10.1016/j.bbadis.2006.06.008. Epub 2006 Jul 1. PubMed PMID: 16891099. See more on PubMed
  • Nakano Y, Tajima S, Yoshimi A, Akiyama H, Tsushima M, Tanioka T, Negoro T, Tomita M, Tobe T. A novel enzyme-linked immunosorbent assay specific for high-molecular-weight adiponectin. J Lipid Res. 2006 Jul;47(7):1572-82. doi: 10.1194/jlr.D600010-JLR200. Epub 2006 Apr 7. PubMed PMID: 16603722. See more on PubMed
  • Richards AA, Stephens T, Charlton HK, Jones A, Macdonald GA, Prins JB, Whitehead JP. Adiponectin multimerization is dependent on conserved lysines in the collagenous domain: evidence for regulation of multimerization by alterations in posttranslational modifications. Mol Endocrinol. 2006 Jul;20(7):1673-87. doi: 10.1210/me.2005-0390. Epub 2006 Feb 23. PubMed PMID: 16497731. See more on PubMed
  • Richards AA, Hickman IJ, Wang AY, Jones AL, Newell F, Mowry BJ, Whitehead JP, Prins JB, Macdonald GA. Olanzapine treatment is associated with reduced high molecular weight adiponectin in serum: a potential mechanism for olanzapine-induced insulin resistance in patients with schizophrenia. J Clin Psychopharmacol. 2006 Jun;26(3):232-7. doi: 10.1097/01.jcp.0000218404.64619.52. PubMed PMID: 16702887. See more on PubMed
  • Wang Y, Lam KS, Chan L, Chan KW, Lam JB, Lam MC, Hoo RC, Mak WW, Cooper GJ, Xu A. Post-translational modifications of the four conserved lysine residues within the collagenous domain of adiponectin are required for the formation of its high molecular weight oligomeric complex. J Biol Chem. 2006 Jun 16;281(24):16391-400. doi: 10.1074/jbc.M513907200. Epub 2006 Apr 18. PubMed PMID: 16621799. See more on PubMed
  • Lara-Castro C, Luo N, Wallace P, Klein RL, Garvey WT. Adiponectin multimeric complexes and the metabolic syndrome trait cluster. Diabetes. 2006 Jan;55(1):249-59. PubMed PMID: 16380500. See more on PubMed
  • Peake PW, Kriketos AD, Campbell LV, Shen Y, Charlesworth JA. The metabolism of isoforms of human adiponectin: studies in human subjects and in experimental animals. Eur J Endocrinol. 2005 Sep;153(3):409-17. doi: 10.1530/eje.1.01978. PubMed PMID: 16131604. See more on PubMed
  • Fisher FM, Trujillo ME, Hanif W, Barnett AH, McTernan PG, Scherer PE, Kumar S. Serum high molecular weight complex of adiponectin correlates better with glucose tolerance than total serum adiponectin in Indo-Asian males. Diabetologia. 2005 Jun;48(6):1084-7. doi: 10.1007/s00125-005-1758-7. Epub 2005 May 19. PubMed PMID: 15902402. See more on PubMed
  • Wang Y, Lam KS, Xu JY, Lu G, Xu LY, Cooper GJ, Xu A. Adiponectin inhibits cell proliferation by interacting with several growth factors in an oligomerization-dependent manner. J Biol Chem. 2005 May 6;280(18):18341-7. doi: 10.1074/jbc.M501149200. Epub 2005 Feb 25. PubMed PMID: 15734737. See more on PubMed
  • Xu A, Chan KW, Hoo RL, Wang Y, Tan KC, Zhang J, Chen B, Lam MC, Tse C, Cooper GJ, Lam KS. Testosterone selectively reduces the high molecular weight form of adiponectin by inhibiting its secretion from adipocytes. J Biol Chem. 2005 May 6;280(18):18073-80. doi: 10.1074/jbc.M414231200. Epub 2005 Mar 9. PubMed PMID: 15760892. See more on PubMed
  • Hug C, Lodish HF. The role of the adipocyte hormone adiponectin in cardiovascular disease. Curr Opin Pharmacol. 2005 Apr;5(2):129-34. doi: 10.1016/j.coph.2005.01.001. PubMed PMID: 15780820. See more on PubMed
  • Waki H, Yamauchi T, Kamon J, Kita S, Ito Y, Hada Y, Uchida S, Tsuchida A, Takekawa S, Kadowaki T. Generation of globular fragment of adiponectin by leukocyte elastase secreted by monocytic cell line THP-1. Endocrinology. 2005 Feb;146(2):790-6. doi: 10.1210/en.2004-1096. Epub 2004 Nov 4. PubMed PMID: 15528304. See more on PubMed
  • Hug C, Wang J, Ahmad NS, Bogan JS, Tsao TS, Lodish HF. T-cadherin is a receptor for hexameric and high-molecular-weight forms of Acrp30/adiponectin. Proc Natl Acad Sci U S A. 2004 Jul 13;101(28):10308-13. doi: 10.1073/pnas.0403382101. Epub 2004 Jun 21. PubMed PMID: 15210937. PubMed CentralPMCID: PMC478568. See more on PubMed
  • Tonelli J, Li W, Kishore P, Pajvani UB, Kwon E, Weaver C, Scherer PE, Hawkins M. Mechanisms of early insulin-sensitizing effects of thiazolidinediones in type 2 diabetes. Diabetes. 2004 Jun;53(6):1621-9. doi: 10.2337/diabetes.53.6.1621. PubMed PMID: 15161771. See more on PubMed
  • Kobayashi H, Ouchi N, Kihara S, Walsh K, Kumada M, Abe Y, Funahashi T, Matsuzawa Y. Selective suppression of endothelial cell apoptosis by the high molecular weight form of adiponectin. Circ Res. 2004 Mar 5;94(4):e27-31. doi: 10.1161/01.RES.0000119921.86460.37. Epub 2004 Jan 29. PubMed PMID: 14752031. PubMed CentralPMCID: PMC4374479. See more on PubMed
  • Pajvani UB, Hawkins M, Combs TP, Rajala MW, Doebber T, Berger JP, Wagner JA, Wu M, Knopps A, Xiang AH, Utzschneider KM, Kahn SE, Olefsky JM, Buchanan TA, Scherer PE. Complex distribution, not absolute amount of adiponectin, correlates with thiazolidinedione-mediated improvement in insulin sensitivity. J Biol Chem. 2004 Mar 26;279(13):12152-62. doi: 10.1074/jbc.M311113200. Epub 2003 Dec 29. PubMed PMID: 14699128. See more on PubMed
  • Chen H, Montagnani M, Funahashi T, Shimomura I, Quon MJ. Adiponectin stimulates production of nitric oxide in vascular endothelial cells. J Biol Chem. 2003 Nov 7;278(45):45021-6. doi: 10.1074/jbc.M307878200. Epub 2003 Aug 27. PubMed PMID: 12944390. See more on PubMed
  • Waki H, Yamauchi T, Kamon J, Ito Y, Uchida S, Kita S, Hara K, Hada Y, Vasseur F, Froguel P, Kimura S, Nagai R, Kadowaki T. Impaired multimerization of human adiponectin mutants associated with diabetes. Molecular structure and multimer formation of adiponectin. J Biol Chem. 2003 Oct 10;278(41):40352-63. doi: 10.1074/jbc.M300365200. Epub 2003 Jul 23. PubMed PMID: 12878598. See more on PubMed
  • Xu A, Wang Y, Keshaw H, Xu LY, Lam KS, Cooper GJ. The fat-derived hormone adiponectin alleviates alcoholic and nonalcoholic fatty liver diseases in mice. J Clin Invest. 2003 Jul;112(1):91-100. doi: 10.1172/JCI17797. PubMed PMID: 12840063. PubMed CentralPMCID: PMC162288. See more on PubMed
  • Pajvani UB, Du X, Combs TP, Berg AH, Rajala MW, Schulthess T, Engel J, Brownlee M, Scherer PE. Structure-function studies of the adipocyte-secreted hormone Acrp30/adiponectin. Implications fpr metabolic regulation and bioactivity. J Biol Chem. 2003 Mar 14;278(11):9073-85. doi: 10.1074/jbc.M207198200. Epub 2002 Dec 20. PubMed PMID: 12496257. See more on PubMed
  • Yamauchi T, Kamon J, Minokoshi Y, Ito Y, Waki H, Uchida S, Yamashita S, Noda M, Kita S, Ueki K, Eto K, Akanuma Y, Froguel P, Foufelle F, Ferre P, Carling D, Kimura S, Nagai R, Kahn BB, Kadowaki T. Adiponectin stimulates glucose utilization and fatty-acid oxidation by activating AMP-activated protein kinase. Nat Med. 2002 Nov;8(11):1288-95. doi: 10.1038/nm788. Epub 2002 Oct 7. PubMed PMID: 12368907. See more on PubMed
  • Okamoto Y, Kihara S, Ouchi N, Nishida M, Arita Y, Kumada M, Ohashi K, Sakai N, Shimomura I, Kobayashi H, Terasaka N, Inaba T, Funahashi T, Matsuzawa Y. Adiponectin reduces atherosclerosis in apolipoprotein E-deficient mice. Circulation. 2002 Nov 26;106(22):2767-70. doi: 10.1161/01.cir.0000042707.50032.19. PubMed PMID: 12451000. See more on PubMed
  • Matsuda M, Shimomura I, Sata M, Arita Y, Nishida M, Maeda N, Kumada M, Okamoto Y, Nagaretani H, Nishizawa H, Kishida K, Komuro R, Ouchi N, Kihara S, Nagai R, Funahashi T, Matsuzawa Y. Role of adiponectin in preventing vascular stenosis. The missing link of adipo-vascular axis. J Biol Chem. 2002 Oct 4;277(40):37487-91. doi: 10.1074/jbc.M206083200. Epub 2002 Jul 22. PubMed PMID: 12138120. See more on PubMed
  • Berg AH, Combs TP, Scherer PE. ACRP30/adiponectin: an adipokine regulating glucose and lipid metabolism. Trends Endocrinol Metab. 2002 Mar;13(2):84-9. doi: 10.1016/s1043-2760(01)00524-0. PubMed PMID: 11854024. See more on PubMed
  • Wang Y, Xu A, Knight C, Xu LY, Cooper GJ. Hydroxylation and glycosylation of the four conserved lysine residues in the collagenous domain of adiponectin. Potential role in the modulation of its insulin-sensitizing activity. J Biol Chem. 2002 May 31;277(22):19521-9. doi: 10.1074/jbc.M200601200. Epub 2002 Mar 23. PubMed PMID: 11912203. See more on PubMed
  • Berg AH, Combs TP, Du X, Brownlee M, Scherer PE. The adipocyte-secreted protein Acrp30 enhances hepatic insulin action. Nat Med. 2001 Aug;7(8):947-53. doi: 10.1038/90992. PubMed PMID: 11479628. See more on PubMed
  • Yamauchi T, Kamon J, Waki H, Terauchi Y, Kubota N, Hara K, Mori Y, Ide T, Murakami K, Tsuboyama-Kasaoka N, Ezaki O, Akanuma Y, Gavrilova O, Vinson C, Reitman ML, Kagechika H, Shudo K, Yoda M, Nakano Y, Tobe K, Nagai R, Kimura S, Tomita M, Froguel P, Kadowaki T. The fat-derived hormone adiponectin reverses insulin resistance associated with both lipoatrophy and obesity. Nat Med. 2001 Aug;7(8):941-6. doi: 10.1038/90984. PubMed PMID: 11479627. See more on PubMed
Summary References (17)

References to Adiponectin

  • Lam KS, Xu A. Adiponectin: protection of the endothelium. Curr Diab Rep. 2005, 5, 254–259.
  • Ding X, Saxena NK, Lin S, Xu A, Srinivasan S, Anania FA. The roles of leptin and adiponectin: a novel paradigm in adipocytokine regulation of liver fibrosis and stellate cell biology. Am J Pathol. 2005, 166, 1655–1669.
  • Xu A, Chan KW, Hoo RL, Wang Y, Tan KC, Zhang J, Chen B, Lam MC, Tse C, Cooper GJ, Lam KS. Testosterone selectively reduces the high molecular weight form of adiponectin by inhibiting its secretion from adipocytes. J Biol Chem. 2005, 280, 18073–18080.
  • Wang Y, Lam KS, Xu JY, Lu G, Xu LY, Cooper GJ, Xu A. Adiponectin inhibits cell proliferation by interacting with several growth factors in an oligomerization-dependent manner. J Biol Chem. 2005, 280, 18341–18347.
  • Ouchi N, Kobayashi H, Kihara S, Kumada M, Sato K, Inoue T, Funahashi T, Walsh K. Adiponectin stimulates angiogenesis by promoting cross-talk between AMP-activated protein kinase and Akt signaling in endothelial cells. J Biol Chem. 2004, 279, 1304–1309.
  • Ishikawa Y, Akasaka Y, Ishii T, Yoda-Murakami M, Choi-Miura NH, Tomita M, Ito K, Zhang L, Akishima Y, Ishihara M, Muramatsu M, Taniyama M. Changes in the distribution pattern of gelatinbinding protein of 28 kDa (adiponectin) in myocardial remodelling after ischaemic injury. Histopathology. 2003, 42, 43–52.
  • Diez JJ, Iglesias P. The role of the novel adipocyte-derived hormone adiponectin in human disease. Eur J Endocrinol. 2003, 148, 293–300.
  • Waki H, Yamauchi T, Kamon J, Ito Y, Uchida S, Kita S, Hara K, Hada Y, Vasseur F, Froguel P, Kimura S, Nagai R, Kadowaki T. Impaired multimerization of human adiponectin mutants associated with diabetes. Molecular structure and multimer formation of adiponectin. J Biol Chem. 2003, 278, 40352–40363.
  • Yamauchi T, Kamon J, Ito Y, Tsuchida A, Yokomizo T, Kita S, Sugiyama T, Miyagishi M, Hara K, Tsunoda M, Murakami K, Ohteki T, Uchida S, Takekawa S, Waki H, Tsuno NH, Shibata Y, Terauchi Y, Froguel P, Tobe K, Koyasu S, Taira K, Kitamura T, Shimizu T, Nagai R, Kadowaki T. Cloning of adiponectin receptors that mediate antidiabetic metabolic effects. Nature. 2003, 423, 762–769.
  • Yamauchi T, Kamon J, Waki H, Imai Y, Shimozawa N, Hioki K, Uchida S, Ito Y, Takakuwa K, Matsui J, Takata M, Eto K, Terauchi Y, Komeda K, Tsunoda M, Murakami K, Ohnishi Y, Naitoh T, Yamamura K, Ueyama Y, Froguel P, Kimura S, Nagai R, Kadowaki T. Globular adiponectin protected ob/ob mice from diabetes and ApoE-deficient mice from atherosclerosis. J Biol Chem. 2003, 278, 2461–2468.
  • Daimon M, Oizumi T, Saitoh T, Kameda W, Hirata A, Yamaguchi H, Ohnuma H, Igarashi M, Tominaga M, Kato T. Decreased serum levels of adiponectin are a risk factor for the progression to type 2 diabetes in the Japanese Population: the Funagata study. Diabetes Care. 2003 Jul;26(7):2015–20.
  • Pajvani UB, Du X, Combs TP, Berg AH, Rajala MW, Schulthess T, Engel J, Brownlee M, Scherer PE. Structure-function studies of the adipocyte-secreted hormone Acrp30/adiponectin. Implications for metabolic regulation and bioactivity. J Biol Chem. 2003, 278, 9073–9085.
  • Spranger J, Kroke A, Mohlig M, Bergmann MM, Ristow M, Boeing H, Pfeiffer AF. Adiponectin and protection against type 2 diabetes mellitus. Lancet. 2003, 361, 226–228.
  • Kondo H, Shimomura I, Matsukawa Y, Kumada M, Takahashi M, Matsuda M, Ouchi N, Kihara S, Kawamoto T, Sumitsuji S, Funahashi T, Matsuzawa Y. Association of adiponectin mutation with type 2 diabetes: a candidate gene for the insulin resistance syndrome. Diabetes. 2002, 51, 2325–2328.
  • Wang Y, Xu A, Knight C, Xu LY, Cooper GJ. Hydroxylation and glycosylation of the four conserved lysine residues in the collagenous domain of adiponectin. Potential role in the modulation of its insulin-sensitizing activity. J Biol Chem. 2002, 277, 19521–19529.
  • Tsao TS, Lodish HF, Fruebis J. ACRP30, a new hormone controlling fat and glucose metabolism. Eur J Pharmacol. 2002, 440, 213–21.
  • Das K, Lin Y, Widen E, Zhang
Related Products

By Research Topic

Chronic renal failure
Coronary artery disease
Diabetology - Other Relevant Products
Energy metabolism and body weight regulation

By Molecule

Adiponectin

By Technical Data

Adiponectin - Antibodies
Adiponectin - Polyclonal Antibody - Antibodies
Human - Adiponectin - Antibodies
Adiponectin - from Sheep - Antibodies
Adiponectin - for Western blotting - Antibodies
Adiponectin - for ELISA - Antibodies
Adiponectin - for Immunohistochemistry - Antibodies
Adiponectin - Antigene from HEK293 - Antibodies
Polyclonal Antibody - Antibodies
Human - Polyclonal Antibody - Antibodies
Polyclonal Antibody - from Sheep - Antibodies
Polyclonal Antibody - for Western blotting - Antibodies
Polyclonal Antibody - for ELISA - Antibodies
Polyclonal Antibody - for Immunohistochemistry - Antibodies
Polyclonal Antibody - Antigene from HEK293 - Antibodies
Human - Antibodies
Human - from Sheep - Antibodies
Human - for Western blotting - Antibodies
Human - for ELISA - Antibodies
Human - for Immunohistochemistry - Antibodies
Human - Antigene from HEK293 - Antibodies
from Sheep - Antibodies
from Sheep - for Western blotting - Antibodies
from Sheep - for ELISA - Antibodies
from Sheep - for Immunohistochemistry - Antibodies
from Sheep - Antigene from HEK293 - Antibodies
for Western blotting - Antibodies
for Western blotting - Antigene from HEK293 - Antibodies
for ELISA - Antibodies
for ELISA - Antigene from HEK293 - Antibodies
for Immunohistochemistry - Antibodies
for Immunohistochemistry - Antigene from HEK293 - Antibodies
Antigene from HEK293 - Antibodies

Docs
Print