Prolactin-Inducible Protein Human, Rabbit Polyclonal Antibody

Cat. No.	Size	Price 1 pc / 2 - 5 pcs / 6+ pcs
RD181304100	0.1 mg	$300 / $266 / On request

Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, Immunohistochemistry

Antibodies Applications

Source of Antigen

Human seminal plasma

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the native Human Prolactin-Inducible Protein.

Amino Acid Sequence

Native protein isolated from pooled human seminal plasma, 118 AA, MW 13.52 kDa (calculated without glycosylation). Protein identity confirmed by LC-MS/MS (NCBI no. gi|4505821).

QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized native Human Prolactin-Inducible Protein.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Oncology, Reproduction

Summary

Prolactin inducible protein (PIP) is a 17-kDa glycoprotein present in human seminal plasma. PIP is synthesized as a 146-amino acid long polypeptide and shows high sequence similarity with mouse submaxillary gland with a single glycosylation site. PIP is known variously as gross cystic breast cyst fluid protein-15 (GCDFP-15), a marker of human primary and metastatic apocrine breast carcinomas, or gp 17/secretory actin binding protein (SABP)/extra-parotid glycoprotein (EP-GP), a secretory glycoprotein isolated from seminal vesicles, salivary glands and sweat glands The exact biological functions of PIP are still uncertain but various functions have been assigned to PIP due its occurrence at high concentration in biological fluids. PIP binds to many proteins such as fibrinogen, actin, keratin, myosin and tropomyosin. PIP is expressed in pathological conditions of the mammary gland and in several exocrine tissues, such as the lacrimal, salivary,and sweat glands. Because of its association with secretory cell differentiation, PIP has been used in diagnostic evaluation of tumors of breast, salivary gland, and skin.

Summary References (16)

References to Prolactin-Inducible Protein

Chiu WW, Chamley LW. Human seminal plasma prolactin-inducible protein is an immunoglobulin G-binding protein. J Reprod Immunol. 2003 Dec;60 (2):97-111
Clark JW, Snell L, Shiu RP, Orr FW, Maitre N, Vary CP, Cole DJ, Watson PH. The potential role for prolactin-inducible protein (PIP) as a marker of human breast cancer micrometastasis. Br J Cancer. 1999 Nov;81 (6):1002-8
Debily MA, Marhomy SE, Boulanger V, Eveno E, Mariage-Samson R, Camarca A, Auffray C, Piatier-Tonneau D, Imbeaud S. A functional and regulatory network associated with PIP expression in human breast cancer. PLoS One. 2009;4 (3):e4696
Hassan MI, Bilgrami S, Kumar V, Singh N, Yadav S, Kaur P, Singh TP. Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma. J Mol Biol. 2008 Dec 19;384 (3):663-72
Hassan MI, Kumar V, Singh TP, Yadav S. Purification and characterization of zinc alpha2-glycoprotein-prolactin inducible protein complex from human seminal plasma. J Sep Sci. 2008 Jul;31 (12):2318-24
Hassan MI, Waheed A, Yadav S, Singh TP, Ahmad F. Prolactin inducible protein in cancer, fertility and immunoregulation: structure, function and its clinical implications. Cell Mol Life Sci. 2009 Feb;66 (3):447-59
Kitano T, Tian W, Umetsu K, Yuasa I, Yamazaki K, Saitou N, Osawa M. Origin and evolution of gene for prolactin-induced protein. Gene. 2006 Nov 15;383:64-70
Kumar S, Tomar AK, Singh S, Saraswat M, Singh S, Singh TP, Yadav S. Human serum albumin as a new interacting partner of prolactin inducible protein in human seminal plasma. Int J Biol Macromol. 2012 Mar 1;50 (2):317-22
Kumar V, Hassan MI, Kashav T, Singh TP, Yadav S. Heparin-binding proteins of human seminal plasma: purification and characterization. Mol Reprod Dev. 2008 Dec;75 (12):1767-74
Murphy LC, Tsuyuki D, Myal Y, Shiu RP. Isolation and sequencing of a cDNA clone for a prolactin-inducible protein (PIP). Regulation of PIP gene expression in the human breast cancer cell line, T-47D. J Biol Chem. 1987 Nov 5;262 (31):15236-41
Myal Y, Robinson DB, Iwasiow B, Tsuyuki D, Wong P, Shiu RP. The prolactin-inducible protein (PIP/GCDFP-15) gene: cloning, structure and regulation. Mol Cell Endocrinol. 1991 Sep;80 (1-3):165-75
Naderi A, Meyer M. Prolactin-induced protein mediates cell invasion and regulates integrin signaling in estrogen receptor-negative breast cancer. Breast Cancer Res. 2012;14 (4):R111
Osawa M, Seto Y, Yukawa N, Saito T, Takeichi S. A 20-kDa protein in human seminal plasma that is identical to gross cystic disease fluid protein 15 and prolactin-inducible protein. Arch Androl. 1996 Jan-Feb;36 (1):29-39
Schaller J, Akiyama K, Kimura H, Hess D, Affolter M, Rickli EE. Primary structure of a new actin-binding protein from human seminal plasma. Eur J Biochem. 1991 Mar 28;196 (3):743-50
Shiu RP, Iwasiow BM. Prolactin-inducible proteins in human breast cancer cells. J Biol Chem. 1985 Sep 15;260 (20):11307-13
Tian W, Osawa M, Horiuchi H, Tomita Y. Expression of the prolactin-inducible protein (PIP/GCDFP15) gene in benign epithelium and adenocarcinoma of the prostate. Cancer Sci. 2004 Jun;95 (6):491-5

Docs

Product Datasheet (RUO)

Datasheet PDF (RUO)

Safety Information (RUO)

MSDS (RUO)