Nesfatin-1 Human E. coli

Cat. No.	Size	Price 1 - 4 pcs / 5 - 9 pcs / 10+ pcs
RD172227100	0.1 mg	$421 / $370 / On request

Technical Data

Type

Recombinant protein

Description

Total 92 AA. MW: 10.79 kDa (calculated). UniProtKB acc.no. D3DQX5. N-Terminal His-tag, 10 extra AA.

Amino Acid Sequence

MKHHHHHHASVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

14% SDS-PAGE separation of Human Nesfatin
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 20mM TRIS, 50mM NaCl, pH 7.5

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at -80 °C. Lyophilized protein remains stable until the expiry date when stored at -80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein. Endotoxin level determination.

Note

This product is intended for research use only.

Summary

Research topic

Energy metabolism and body weight regulation, Neural tissue markers

Summary

Nesfatin-1 was first described in 2006 as a neurohormone derived from the protein NEFA/nucleobindin2 (NUCB2). It is a polypeptide consisting of 82 amino acids, with high level of homology in human, mouse and rat. Nesfatin-1 has been localized in the brain, particulary in the nuclei of the hypothalamus, in the adipose tissue and the gastrointestinal tract, but also in serum and cerebrospinal fluid. Nesfatin-1 was identified as a satiety molecule affecting fat metabolism. Intracerebroventricular administration of nesfatin-1 induces decreases in food intake and body weight and increases in sympathetic nerve activity and mean arterial pressure. Effect of Nesfatin-1 is leptin – independent, it is probably mediated by melanocortin system. Several studies are currently focused on the possibility of using Nesfatin-1 in the treatment of obesity, even in individuals with leptin resistence. Due to the presence in serum Nesfatin-1 could also serve as a clinical marker in the diagnosis of many diseases. The important role of nesfatin-1 in metabolism of glucose and insulin has been reported in several studies. Different concentrations were observed in patients with diabetes mellitus type I. and II. In individuals with DM type II. postprandial concentration of nesfatin-1 was significantly lower than that of DM type I. and healthy subjects. Different levels of Nesfatin-1 was measured in patients with anorexia nervosa and panic disorders in comparison with a control healthy group. Data obtained in experiments with rat models indicate that nesfatin-1 acts as a peripheral modulator of the cardiac function. Much higher levels of serum Nesfatin-1 (up to 160×) were detected in patients with primarily diagnosed epilepsy. During the treatment with anti-epileptics concentration of Nesfatin-1 decreased, but it was still about 10 times higher that the level of the hormone in healthy individuals. It offers the idea that it would be possible to use the Nesfatin-1 as a marker for diagnosis and monitoring of epilepsy.

Summary References (17)

References to Nesfatin-1

Angelone T, Filice E, Pasqua T, Amodio N, Galluccio M, Montesanti G, Quintieri AM, Cerra MC. Nesfatin-1 as a novel cardiac peptide: identification, functional characterization, and protection against ischemia/reperfusion injury. Cell Mol Life Sci. 2012 Sep 7;
Aydin S, Dag E, Ozkan Y, Arslan O, Koc G, Bek S, Kirbas S, Kasikci T, Abasli D, Gokcil Z, Odabasi Z, Catak Z. Time-dependent changes in the serum levels of prolactin, nesfatin-1 and ghrelin as a marker of epileptic attacks young male patients. Peptides. 2011 Jun;32 (6):1276-80
Aydin S, Dag E, Ozkan Y, Erman F, Dagli AF, Kilic N, Sahin I, Karatas F, Yoldas T, Barim AO, Kendir Y. Nesfatin-1 and ghrelin levels in serum and saliva of epileptic patients: hormonal changes can have a major effect on seizure disorders. Mol Cell Biochem. 2009 Aug;328 (1-2):49-56
Bez Y, Ari M et al. Plasma nesfatin-1 level may be associated with disease severity in patiens with panic disorders. Bull Clin Psychpharm. 2010;20:288-292
Bonnet MS, Djelloul M, Tillement V, Tardivel C, Mounien L, Trouslard J, Troadec JD, Dallaporta M. Central NUCB2/Nesfatin-1-Expressing Neurones Belong to the Hypothalamic-Brainstem Circuitry Activated by Hypoglycaemia. J Neuroendocrinol. 2013 Jan;25 (1):1-13
Brailoiu GC, Dun SL, Brailoiu E, Inan S, Yang J, Chang JK, Dun NJ. Nesfatin-1: distribution and interaction with a G protein-coupled receptor in the rat brain. Endocrinology. 2007 Oct;148 (10):5088-94
Garcia-Galiano D, Navarro VM, Roa J, Ruiz-Pino F, Sanchez-Garrido MA, Pineda R, Castellano JM, Romero M, Aguilar E, Gaytan F, Dieguez C, Pinilla L, Tena-Sempere M. The anorexigenic neuropeptide, nesfatin-1, is indispensable for normal puberty onset in the female rat. J Neurosci. 2010 Jun 9;30 (23):7783-92
Gonzalez R, Reingold BK, Gao X, Gaidhu MP, Tsushima RG, Unniappan S. Nesfatin-1 exerts a direct, glucose-dependent insulinotropic action on mouse islet beta- and MIN6 cells. J Endocrinol. 2011 Mar;208 (3):R9-R16
Li QC, Wang HY, Chen X, Guan HZ, Jiang ZY. Fasting plasma levels of nesfatin-1 in patients with type 1 and type 2 diabetes mellitus and the nutrient-related fluctuation of nesfatin-1 level in normal humans. Regul Pept. 2010 Jan 8;159 (1-3):72-7
Nakata M, Manaka K, Yamamoto S, Mori M, Yada T. Nesfatin-1 enhances glucose-induced insulin secretion by promoting Ca(2+) influx through L-type channels in mouse islet beta-cells. Endocr J. 2011;58 (4):305-13
Ogiso K, Asakawa A, Amitani H, Nakahara T, Ushikai M, Haruta I, Koyama K, Amitani M, Harada T, Yasuhara D, Inui A. Plasma nesfatin-1 concentrations in restricting-type anorexia nervosa. Peptides. 2011 Jan;32 (1):150-3
Oh-I S, Shimizu H, Satoh T, Okada S, Adachi S, Inoue K, Eguchi H, Yamamoto M, Imaki T, Hashimoto K, Tsuchiya T, Monden T, Horiguchi K, Yamada M, Mori M. Identification of nesfatin-1 as a satiety molecule in the hypothalamus. Nature. 2006 Oct 12;443 (7112):709-12
Ramanjaneya M, Chen J, Brown JE, Tripathi G, Hallschmid M, Patel S, Kern W, Hillhouse EW, Lehnert H, Tan BK, Randeva HS. Identification of nesfatin-1 in human and murine adipose tissue: a novel depot-specific adipokine with increased levels in obesity. Endocrinology. 2010 Jul;151 (7):3169-80
Riva M, Nitert MD, Voss U, Sathanoori R, Lindqvist A, Ling C, Wierup N. Nesfatin-1 stimulates glucagon and insulin secretion and beta cell NUCB2 is reduced in human type 2 diabetic subjects. Cell Tissue Res. 2011 Dec;346 (3):393-405
Shimizu H, Oh-I S, Hashimoto K, Nakata M, Yamamoto S, Yoshida N, Eguchi H, Kato I, Inoue K, Satoh T, Okada S, Yamada M, Yada T, Mori M. Peripheral administration of nesfatin-1 reduces food intake in mice: the leptin-independent mechanism. Endocrinology. 2009 Feb;150 (2):662-71
Shimizu H, Oh-I S, Okada S, Mori M. Nesfatin-1: an overview and future clinical application. Endocr J. 2009;56 (4):537-43
Stengel A, Goebel M, Yakubov I, Wang L, Witcher D, Coskun T, Tache Y, Sachs G, Lambrecht NW. Identification and characterization of nesf

Docs

Product Datasheet (RUO)

Datasheet PDF (RUO)
Datasheet PDF (RUO)

Safety Information (RUO)

MSDS (RUO)