United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Regenerating Protein 1 beta Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:REG 1 beta, Lithostathine-1-beta, Regenerating islet-derived protein 1-beta, REG-1-beta, Regenerating protein I beta, Pancreatic stone protein 2, PSP-2, REG1B, PSPS2, REGL, Protein kinase C nu, PKC nu
  • Species:Human
Cat. No. Size Price
1 - 4 pcs / 5 - 9 pcs / 10+ pcs


RD172084100 0.1 mg $421 / $370 / On request
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 156 AA. MW: 17.8 kDa (calculated). UniProtKB acc.no. P48304. N-Terminal His-tag 12 AA.

Amino Acid Sequence

MKHHHHHHASHMQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

12% SDS-PAGE separation of Human Reg1 beta
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 2.5μg/lane
3. non-reduced and non-heated sample, 2.5μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in 20 mM Tris buffer, 50 mM NaCl, pH 8.0.

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at -80 °C. Lyophilized protein remains stable until the expiry date when stored at -80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein. Endotoxin level determination.

Note

This product is intended for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Pancreatic regulatory molecules, Animal studies

Summary References (5)

References to Regenerating Protein 1 beta

  • Boonyasrisawat W, Pulsawat P, Yenchitsomanus PT, Vannasaeng S, Pramukkul P, Deerochanawong C, Sriussadaporn S, Ploybutr S, Pasurakul T, Banchuin N. Analysis of the reg1alpha and reg1beta gene transcripts in patients with fibrocalculous pancreatopathy. Southeast Asian J Trop Med Pub. 2002 Jun;33 (2):365-72
  • Kinoshita Y, Ishihara S, Kadowaki Y, Fukui H, Chiba T. Reg protein is a unique growth factor of gastric mucosal cells. J Gastroenterol. 2004 Jun;39 (6):507-13
  • Okamoto H. The Reg gene family and Reg proteins: with special attention to the regeneration of pancreatic beta-cells. J Hepatobiliary Pancreat Surg. 1999;6 (3):254-62
  • Tezel E, Nagasaka T, Tezel G, Kaneko T, Takasawa S, Okamoto H, Nakao A. REG I as a marker for human pancreatic acinoductular cells. Hepatogastroenterology. 2004 Jan-Feb;51 (55):91-6
  • Zhang YW, Ding LS, Lai MD. Reg gene family and human diseases. World J Gastroenterol. 2003 Dec;9 (12):2635-41
Related Products Docs