Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

Proguanylin Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Guanylate cyclase activator 2A, Guanylate cyclase-activating protein 1, Guanylate cyclase-activating protein I, GCAP-I, GUCA2A, GUCA2
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RD172046025 0.025 mg
RD172046100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 104 AA. MW: 11,5 kDa (calculated). UniProtKB acc.no. Q02747 (Val22-Cys115). N-terminal His-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 90%

SDS-PAGE Gel

14% SDS-PAGE separation of Human Proguanylin
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 2.5μg/lane
3. non-reduced and non-heated sample, 2.5μg/lane

Endotoxin

< 0.1 EU/μg

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in deionized H2O.

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for three days.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Others, Renal disease

Summary

Proguanylin, the 116-amino acid prohormone, is a bioactive form of human guanylin that acts on intestinal guanylate cyclase, thereby regulating intestinal fluid and elektrolyte transport through the second messenger, cyclic GMP (cGMP). The cGMP increase inhibits salt absorption and stimulates chloride secretion into the gut. This imbalance of ions is accompanied by a massive accumulation of water in the gut that gives rise to diarrhea and dehydratation characteristic of enterotoxin activity. Proguanylin is found in circulation and plays an endocrine role by regulating the function of tissues such as the kidney and liver. Proguanylin is a significant marker in renal insufficiency. Plasma levels of proguanylin increase in patients with chronic renal failure who were undergoing hemodialysis. Studies have shown, that serum levels of Proguanylin has rise in patients with Cohn syndrome therefore it could be used as a novel marker in diagnostic and therapy of cardiac failure.

Summary References (7)

References to Proguanylin

  • Fan X, Wang Y, London R M, Eber S L, Kruse W J, Freeman R H, and Forte L R: Signaling Pathways for Guanylin and Uroguanylin in the digestive, Renal, Central Nervous, Reproductive, and Lymphoid Systems. Endocrinology 138, 4636–4648 (1997)
  • Garcia k Ch, Sauvage F J, Strubles M, Henzel W, Reilly D, and Goeddel D V: Processing and Charecterization of Human Proguanylin Expressed in Escherichia coli. The Journal of Biological Chemistry 268, 22397–22401 (1993)
  • Hamra F K, Fan X, Krause W J, et al: Prouroguanylin and Proguanylin: Purification from Colon, Structure, and Modulation of Bioactivyity by Proteases. Endocrinology 137, 257–265 (1996)
  • Rudolph J A, Hawkins J A, and Cohen M B: Proguanylin secretion and role of negative – feedback inhibition in villous epithelial cell line. Am J Physiol Gastrointest Liver Physiol 238 G695-G702 (2002)
  • Lauber T, Neudecker P, Rosch P, and Marx U C: Solution Structure of Human Proguanylin. The Journal of Biological Chemistry 278, 24118–24124 (2003)
  • Lauber T, Nourse A, Schulz A, and Marx U C: Native and Recombinant Proguanylin Feature Identical Biophysical Properties and Are Monomeric in Solution. Biochemistry 41, 14602–14612 (2002)
  • Sauvage J F, Keshav S, Kuang W-J, Gillett N, Henzel W, and Goeddel D V: Precursor structure, expression, and tissue distribution of human guanylin. Biochemistry 89, 9089–9093 (1992)
Related Products Docs