Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Prohibitin Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:PHB
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172239100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 282 AA. MW: 31 kDa (calculated). UniProtKB acc.no. P35232 (Met1-Gln272). N-terminal His-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASMAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

Source

E. coli

Purity

Purity as determined by densitometric image analysis: ≥ 90 %

SDS-PAGE Gel

14% SDS-PAGE separation of Human Prohibitin :
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 2.5μg/lane
3. non-reduced and non-boiled sample, 2.5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 0.02 M tris buffer, 0.05 M NaCl, pH 8.6

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.25 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only

Summary

Summary

Prohibitin is a mitochondrial protein. It restrains DNA synthesis and takes part in proliferation regulation. It may play a role in aging and regulating mitochondrial respiration activity.

Related Products Docs