Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Prokineticin-2 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:PROK2, PK2, Protein Bv8 homolog
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10277005 5 µg
RBG10277020 20 µg
RBG10277100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Prokineticin-2 (PK2) is a cysteine-rich secreted protein that is expressed in the testis and, in lower levels, in the small intestine. PK2 regulates various biological functions, including gastrointestinal motility, angiogenesis and circadian rhythms. It is closely related to EG-VEGF (Prokineticin-1), and binds to two orphan B-protein-coupled receptors termed PK-R1 and PK-R2. Recombinant Human Prokineticin-2 is an 8.8 kDa protein consisting of 81 amino acid residues, including ten cysteine residues that can potentially form five pairs of intra-molecular disulfide bonds.

Amino Acid Sequence

AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK

Source

E. coli

Purity

98%

Biological Activity

Data not available.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Others

Related Products Docs