Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Prolactin-Inducible Protein NATIVE, Human seminal plasma

  • Regulatory status:RUO
  • Type:Native protein
  • Source:Human seminal plasma
  • Other names:Gross cystic disease fluid protein 15, Prolactin-induced protein, Secretory actin-binding protein, GCDFP15, GPIP4, SABP, GP17, PIP
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD164304050 0.05 mg
PubMed Product Details
Technical Data

Type

Native protein

Description

Native protein isolated from pooled human seminal plasma, 118 AA, MW 13,52 kDa (calculated without glycosylation). Protein identity confirmed by LC-MS/MS (NCBI no. gi|4505821).

Amino Acid Sequence

QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE

Source

Human seminal plasma

Purity

>95%

SDS-PAGE Gel

SDS-PAGE analysis of Prolactin-Inducible Protein native protein, 12% gel stained with Coomassie Brillant Blue G250

  1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
  2. reduced and boiled sample, 2.5ug/lane
  3. non-reduced and non-boiled sample, 2.5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 0,05M phosphate buffer, 0,075M NaCl, pH 8,0.

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Applications

Western blotting, ELISA, Cell culture and/or animal studies, Immunological methods

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

All samples used for protein preparation were tested and found negative for HBsAg, HIV1,2, HCV, syphilis, aHBc, RRR. Since no test can absolutely assure the absence of all infectious agents, this product should be handled as a potential biohazard. This product is intended for research use only.

Summary

Research topic

Oncology, Reproduction

Summary

Prolactin inducible protein (PIP) is a 17-kDa glycoprotein present in human seminal plasma. PIP is synthesized as a 146-amino acid long polypeptide and shows high sequence similarity with mouse submaxillary gland with a single glycosylation site. PIP is known variously as gross cystic breast cyst fluid protein-15 (GCDFP-15), a marker of human primary and metastatic apocrine breast carcinomas, or gp 17/secretory actin binding protein (SABP)/extra-parotid glycoprotein (EP-GP), a secretory glycoprotein isolated from seminal vesicles, salivary glands and sweat glands The exact biological functions of PIP are still uncertain but various functions have been assigned to PIP due its occurrence at high concentration in biological fluids. PIP binds to many proteins such as fibrinogen, actin, keratin, myosin and tropomyosin. PIP is expressed in pathological conditions of the mammary gland and in several exocrine tissues, such as the lacrimal, salivary,and sweat glands. Because of its association with secretory cell differentiation, PIP has been used in diagnostic evaluation of tumors of breast, salivary gland, and skin.

Summary References (16)

References to Prolactin-Inducible Protein

  • Chiu WW, Chamley LW. Human seminal plasma prolactin-inducible protein is an immunoglobulin G-binding protein. J Reprod Immunol. 2003 Dec;60 (2):97-111
  • Clark JW, Snell L, Shiu RP, Orr FW, Maitre N, Vary CP, Cole DJ, Watson PH. The potential role for prolactin-inducible protein (PIP) as a marker of human breast cancer micrometastasis. Br J Cancer. 1999 Nov;81 (6):1002-8
  • Debily MA, Marhomy SE, Boulanger V, Eveno E, Mariage-Samson R, Camarca A, Auffray C, Piatier-Tonneau D, Imbeaud S. A functional and regulatory network associated with PIP expression in human breast cancer. PLoS One. 2009;4 (3):e4696
  • Hassan MI, Bilgrami S, Kumar V, Singh N, Yadav S, Kaur P, Singh TP. Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma. J Mol Biol. 2008 Dec 19;384 (3):663-72
  • Hassan MI, Kumar V, Singh TP, Yadav S. Purification and characterization of zinc alpha2-glycoprotein-prolactin inducible protein complex from human seminal plasma. J Sep Sci. 2008 Jul;31 (12):2318-24
  • Hassan MI, Waheed A, Yadav S, Singh TP, Ahmad F. Prolactin inducible protein in cancer, fertility and immunoregulation: structure, function and its clinical implications. Cell Mol Life Sci. 2009 Feb;66 (3):447-59
  • Kitano T, Tian W, Umetsu K, Yuasa I, Yamazaki K, Saitou N, Osawa M. Origin and evolution of gene for prolactin-induced protein. Gene. 2006 Nov 15;383:64-70
  • Kumar S, Tomar AK, Singh S, Saraswat M, Singh S, Singh TP, Yadav S. Human serum albumin as a new interacting partner of prolactin inducible protein in human seminal plasma. Int J Biol Macromol. 2012 Mar 1;50 (2):317-22
  • Kumar V, Hassan MI, Kashav T, Singh TP, Yadav S. Heparin-binding proteins of human seminal plasma: purification and characterization. Mol Reprod Dev. 2008 Dec;75 (12):1767-74
  • Murphy LC, Tsuyuki D, Myal Y, Shiu RP. Isolation and sequencing of a cDNA clone for a prolactin-inducible protein (PIP). Regulation of PIP gene expression in the human breast cancer cell line, T-47D. J Biol Chem. 1987 Nov 5;262 (31):15236-41
  • Myal Y, Robinson DB, Iwasiow B, Tsuyuki D, Wong P, Shiu RP. The prolactin-inducible protein (PIP/GCDFP-15) gene: cloning, structure and regulation. Mol Cell Endocrinol. 1991 Sep;80 (1-3):165-75
  • Naderi A, Meyer M. Prolactin-induced protein mediates cell invasion and regulates integrin signaling in estrogen receptor-negative breast cancer. Breast Cancer Res. 2012;14 (4):R111
  • Osawa M, Seto Y, Yukawa N, Saito T, Takeichi S. A 20-kDa protein in human seminal plasma that is identical to gross cystic disease fluid protein 15 and prolactin-inducible protein. Arch Androl. 1996 Jan-Feb;36 (1):29-39
  • Schaller J, Akiyama K, Kimura H, Hess D, Affolter M, Rickli EE. Primary structure of a new actin-binding protein from human seminal plasma. Eur J Biochem. 1991 Mar 28;196 (3):743-50
  • Shiu RP, Iwasiow BM. Prolactin-inducible proteins in human breast cancer cells. J Biol Chem. 1985 Sep 15;260 (20):11307-13
  • Tian W, Osawa M, Horiuchi H, Tomita Y. Expression of the prolactin-inducible protein (PIP/GCDFP15) gene in benign epithelium and adenocarcinoma of the prostate. Cancer Sci. 2004 Jun;95 (6):491-5
Related Products Docs