Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Prostate-Specific Antigen NATIVE, Human Seminal Plasma

  • Regulatory status:RUO
  • Type:Native protein
  • Source:Human seminal plasma
  • Other names:PSA, Kallikrein-3, Gamma-seminoprotein,P-30 antigen, Semenogelase
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD164335050 0.05 mg
PubMed Product Details
Technical Data

Type

Native protein

Description

Native protein isolated from pooled human seminal plasma, 237 AA, MW 26,089 kDa (calculated without glycosylation). Protein identity confirmed by LC-MS/MS (NCBI no. gi|511857).

Amino Acid Sequence

IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Source

Human seminal plasma

Purity

>90%

SDS-PAGE Gel

SDS-PAGE analysis of Prostate-specific antigen native protein, 14% gel stained with Coomassie Brillant Blue G250

  1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
  2. reduced and boiled sample, 2.5ug/lane
  3. non-reduced and non-boiled sample, 2.5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0,4 μm) and lyophilized in 0,5 mg/mL in 0,05M phosphate buffer, 0,075M NaCl, pH 7,4.

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Applications

Western blotting, ELISA, Cell culture and/or animal studies, Immunological methods

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

All samples used for protein preparation were tested and found negative for HBsAg, HIV1,2, HCV, syphilis, aHBc, RRR. Since no test can absolutely assure the absence of all infectious agents, this product should be handled as a potential biohazard. This product is intended for research use only.

Summary

Research topic

Immune Response, Infection and Inflammation, Oncology, Reproduction

Summary

Prostate-specific antigen (PSA), also known as gamma-seminoprotein or kallikrein-3 (KLK3), is a 33 kDa glycoprotein that is mainly produced by the epithelial cells of the prostate. PSA has been also found to be expressed in many non-prostatic normal or tumor tissues, like breast or breast cancer tissue and breast cancer cells, colon, kidney, liver, parotid, lung, endometrium, periuretral, thyroid and apocrine sweat glands. PSA is present in serum in different molecular isoforms, free or unbound, and bound to serine protease inhibitors. Major part of serum PSA is bound to α-1-antichymotrypsin or α-2-macroglobulin. The normal prostate contains PSA levels about million-fold higher than serum. The normal serum levels of PSA in males are under 4 µg/l, while the PSA levels in the seminal fluid are 10 6 – fold higher, 0.2–5 g/l. The PSA concentration in female serum is much lower than in male, 0.2–0.3 µg/l. PSA is currently used for prostate cancer diagnosis and monitoring of patients with prostate adenocarcinoma. Also about 30% of female breast tumors produce a 33 kDa glycoprotein that has striking similarities to seminal PSA. PSA coud be used as a biomarker for breast cancer prognosis, for the spreading of hematogenous micrometastases.

Summary References (19)

References to Prostate Specific Antigen

  • Banez LL, Hamilton RJ, Partin AW, Vollmer RT, Sun L, Rodriguez C, Wang Y, Terris MK, Aronson WJ, Presti JC Jr, Kane CJ, Amling CL, Moul JW, Freedland SJ. Obesity-related plasma hemodilution and PSA concentration among men with prostate cancer. JAMA. 2007 Nov 21;298 (19):2275-80
  • Cao Y, Ma J. Body mass index, prostate cancer-specific mortality, and biochemical recurrence: a systematic review and meta-analysis. Cancer Prev Res (Phila). 2011 Apr;4 (4):486-501
  • Carter HB. Prostate cancers in men with low PSA levels--must we find them?. N Engl J Med. 2004 May 27;350 (22):2292-4
  • Catalona WJ, Richie JP, Ahmann FR, Hudson MA, Scardino PT, Flanigan RC, deKernion JB, Ratliff TL, Kavoussi LR, Dalkin BL, et al. Comparison of digital rectal examination and serum prostate specific antigen in the early detection of prostate cancer: results of a multicenter clinical trial of 6,630 men. J Urol. 1994 May;151 (5):1283-90
  • Catalona WJ, Smith DS, Ratliff TL, Dodds KM, Coplen DE, Yuan JJ, Petros JA, Andriole GL. Measurement of prostate-specific antigen in serum as a screening test for prostate cancer. N Engl J Med. 1991 Apr 25;324 (17):1156-61
  • Chybowski FM, Bergstralh EJ, Oesterling JE. The effect of digital rectal examination on the serum prostate specific antigen concentration: results of a randomized study. J Urol. 1992 Jul;148 (1):83-6
  • Collins GN, Martin PJ, Wynn-Davies A, Brooman PJ, O'Reilly PH. The effect of digital rectal examination, flexible cystoscopy and prostatic biopsy on free and total prostate specific antigen, and the free-to-total prostate specific antigen ratio in clinical practice. J Urol. 1997 May;157 (5):1744-7
  • Connolly DJ, Black A, Murray LJ, Gavin A, Keane PF. Population based age-specific reference ranges for PSA. Prostate Cancer Symposium. 2007;
  • Crawford ED, Schutz MJ, Clejan S, Drago J, Resnick MI, Chodak GW, Gomella LG, Austenfeld M, Stone NN, Miles BJ, et al. The effect of digital rectal examination on prostate-specific antigen levels. JAMA. 1992 Apr 22-29;267 (16):2227-8
  • Dreicer R. Why do obese men have lower PSA concentrations?. Journal Watch (New England Jou. 2007 (1120);
  • Herschman JD, Smith DS, Catalona WJ. Effect of ejaculation on serum total and free prostate-specific antigen concentrations. Urology. 1997 Aug;50 (2):239-43
  • Monne M, Croce CM, Yu H, Diamandis EP. Molecular characterization of prostate-specific antigen messenger RNA expressed in breast tumors. Cancer Res. 1994 Dec 15;54 (24):6344-7
  • Myrtle JF. Clinical utility of prostate specific antigen (PSA) in the management of prostate cancer. Advances in Cancer Diagnostics. (1986) San Diego: Hybritech In;
  • Myrtle JF. Measurement of Prostate-Specific Antigen (PSA) in Serum by a Two-Site Immunometric Method (Hybritech Tandem-R/Tandem-E PSA). Clinical Aspects of Prostate C. October 16–19, 1988 ;Assessment of New Diagnostic a (New York: Elsevier):161–71
  • Myrtle JF. Normal Levels of Prostate-Specific Antigen (PSA). In Catalona WJ, Coffey DS, Karr JP (eds.). Clinical Aspects of Prostate C. October 16–19, 1988 ;at Prout's Neck, Maine, U.S.A.:183–9
  • Nadler RB, Humphrey PA, Smith DS, Catalona WJ, Ratliff TL. Effect of inflammation and benign prostatic hyperplasia on elevated serum prostate specific antigen levels. J Urol. 1995 Aug;154 (2 Pt 1):407-13
  • Satheesh Babu AK, Vijayalakshmi MA, Smith GJ, Chadha KC. Thiophilic-interaction chromatography of enzymatically active tissue prostate-specific antigen (T-PSA) and its modulation by zinc ions. J Chromatogr B Analyt Technol . 2008 Jan 15;861 (2):227-35
  • Tarhan F, Orcun A, Kucukercan I, Camursoy N, Kuyumcuoglu U. Effect of prostatic massage on serum complexed prostate-specific antigen levels. Urology. 2005 Dec;66 (6):1234-8
  • Thompson IM, Pauler DK, Goodman PJ, Tangen CM, Lucia MS, Parnes HL, Minasian LM, Ford LG, Lippman SM, Crawford ED, Crowley JJ, Coltman CA Jr. Prevalence of prostate cancer among men with a prostate-specific antigen level < or =4.0 ng per milliliter. N Engl J
Related Products Docs