Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Prostate-Specific Gene-1 Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:HPG-1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD181061100 0.1 mg
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant HPG-1.

Amino Acid Sequence

The immunization antigen (16 kDa) is a protein containing 136 AA of recombinant HPG-1 N-Terminal His-tag, 9 extra AA (highlighted)

MKHHHHHHHMIKKNLKKLGIEETYLNIIKAIYDRPTASIQKTENLSTKTGTSQEYHLSPLWFYIVLEILASTIRQEKNLKDIHTEKEEVKLSLFADAMILYLKKPNDSTRKLLELIKKIHSSCRIKINIHFAFCSQ

Species Reactivity

Human. Not yet tested in other species.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody

Note

This product is for research use only.

Summary

Research topic

Oncology

Summary

Human Prostate-Specific Gene-1 (HPG-1) product is a recently discovered membrane-anchored protein of approximately 15 kD. It was detected exclusively in the prostate (19 different tissues were tested). Antisense-oligonicleotide inhibition of HPG-1 expression inhibited the growth of one prostate cancer cell line (LNCaP) significantly (86%). HPG-1 might be a novel diagnostic and/or therapeutic target.

References to Summary

References to Prostate-Specific Gene-1

  • Herness EA, Naz RK. A novel human prostate-specific gene-1 (HPG-1): molecular cloning, sequencing, and its potential involvement in prostate carcinogenesis. Cancer Res. 2003 Jan 15;63 (2):329-36
Related Products Documents