Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Protein Delta Homolog 1 Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293
  • Other names:Pref-1, Protein Delta Homolog 1, Preadipocyte factor 1, DLK-1, pG2, Fetal antigen 1, FA1, Dlk1, Dlk, Pref1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172519100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 290 AA. MW: 31.2 kDa (calculated). UniProtKB acc.no. P80370 (Ala24-Gln303). C-terminal his-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQHHHHHHHHHH

Source

HEK293

Purity

Purity as determined by densitometric image analysis: > 95%

SDS-PAGE Gel

14 % SDS-PAGE separation of Human Pref-1:
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. Reduced and boiled sample, 2.5 μg/lane
3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/μg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in phosphate buffered saline, 5% w/v trehalose, pH7­.4

Reconstitution

Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Energy metabolism and body weight regulation, Oncology

Summary References (12)

References to Protein Delta Homolog 1

  • Jensen CH, Krogh TN, Højrup P, Clausen PP, Skjødt K, Larsson LI, Enghild JJ, Teisner B: Protein structureof fetal antigen 1 (FA1). Eur J Biochem 1994, 225:83-92
  • Jensen CH, Erb K, Westergaard LG, Kliem A, Teisner B: Fetal antigen 1, an EGF multidomain protein in the sex hormone producing cells of the gonads and the microenvironment of germ cells. Molecul Hu Reproduc 1999, 5(10):908-913
  • Sul HS, Smas C, Mei B, Zhou L: Function of pref-1 as an inhibitor of adipocyte differentiation. 2000 Internat J Obesity, 24(4):S15-S19
  • Wang Y, Kim KA, Kim JH Sul HS: Pref-1, a preadipocyte secreted factor that inhibits adipogenesis. J Nutr 2006, 136:2953-2956
  • O´Connell J, Lynch L, Hogan A, Cawood TJ, O´Shea D: Preadipocyte factor-1 is associated with metabolic profile in severe obesity. J clin Endocrin Metab 2011, 96(4):E680-E684
  • Chacón MR, Miranda M, Jensen CH, Fernández-Real JM, Vilarrasa N, Gutiérrez C, Näf S, Gomez JM, Vendrell J: Human serum levels of fetal antigen 1 (FA1/Dlk1) increase with obesity, are negatively associated with insulin sensitivity and modulate inflammation in vitro. Int J Obesity 2008, 32:1122-1129
  • Kavalkova P, Dostalova I, Haluzikova D, Trachta P, Hanusová V, Lacinova Z, Papezova H, Domluvilova D, Zikan V, Haluzik M: Preadipocyte factor-1 concentration in patients with anorexia nervosa: the influence of partial realimentation. Physiol Res 2012, 61:153-159
  • Falix FA, Aronson DC, Lamers WH, Hiralall JK, Seppen J: DLK1, a serum marker for hepatoblastoma in young infants. Pediatr Blood Cancer 2012, 59(4):743-745
  • Mitterberger MC, Lechner S, Mattesich M, Kaiser A, Probst D, Wenger N, Pierer G, Zwerschke W: DLK1(Pref1) is a negative regulator of adipogenesis in CD105+/CD90+/CD34+/CD31-/FABP4- adipose-derived stromal cells from subcutaneous abdominal fat pats of adult women. Stem Cell Res 2012, 9:35-48
  • Andries A, Niemeier A, Stoving RK, Abdallah BM, Wolf AM, Horder K, Kassem M: Serum levels of fetal antigen 1 extreme nutritional states. ISRN Endocrinology 2012, doi:10.5402/2012/592648Andries A, Niemeier A, Stoving RK, Abdallah BM, Wolf AM, Horder K, Kassem M: Serum levels of fetal antigen 1 extreme nutritional states. ISRN Endocrinology 2012, doi:10.5402/2012/592648
  • Hudak CS, Sul HS: Pref-1, a gatekeeper of adipogenesis. Front Endocrin 2013, 4:79 Hudak CS, Sul HS: Pref-1, a gatekeeper of adipogenesis. Front Endocrin 2013, 4:79
  • Li H, Cui ML, Chen TY, Xie HY, Cui Y, Tu H, Chen FH, Ge C, Li JJ: Serum DLK1 is a potential prognostic biomarker in patients with hepatocellular carcinoma. Tumor Biol 2015, 36(11):8399-8404
Related Products Docs