Type
Recombinant protein
Description
Total 96 AA. MW: 10.7 kDa (calculated). N-Terminal His-tag (10 extra AA). UniprotKB acc.no. Q16661
Amino Acid Sequence
MKHHHHHHASVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
Source
E. coli
Purity
Purity as determined by densitometric image analysis: >95%
SDS-PAGE Gel
12% SDS-PAGE separation of Human Prouroguanylin
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 2.5μg/lane
3. non-reduced and non-heated sample, 2.5μg/lane
Endotoxin
< 1.0 EU/ug
Formulation
0.2–0.7 mg/ml in 20mM TRIS, 50mM NaCl, 20% (v/v) glycerol, pH 7.5 – filtered (0.4 μm), frozen
Reconstitution
Defrost at ambient temperature.
Applications
Western blotting, ELISA
Shipping
On ice. Upon receipt, store the product at the temperature recommended below.
Storage/Expiration
Store protein at –80°C. Protein remains stable until the expiry date when stored at –80°C. Avoid repeated freezing/thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
LAL to determine quantity of endotoxin.
Note
This product is intended for research use only.
Research topic
Oncology, Others, Renal disease
Summary
Prouroguanylin (about 9,7 kDa) is a biologically inactive form of uroguanylin circulating in a bloodstream. Uroguanylin is a small –molecular-weight peptide which has been shown to participate in the regulation of salt and water homeostasis in mammals via cGMP-mediated processes in the intestine, kidney and other epithelia. Prouroguanylin levels are markedly increased in chronic renal failure. The severity of chronic renal disease correlates with the magnitude of increases in plasma prouroguanylin concentrations. Uroguanylin/prouroguanylin levels also increased in the nephrotic syndrome. It may be concluded that uroguanylin/prouroguanylin is cleared from the circulation by the kidney and that reduced functioning renal mass and decreased glomerular filtration rates (GFR) lead to substantial increases in the concentrations of these peptides in serum and plasma. Circulating forms of uroguanylin and prouroguanylin are thought to be a major source of the urinary forms of biologically active uroguanylin. Both of these peptides can enter renal tubules by glomerular filtration. Prouroguanylin in the tubular lumen is than converted to active uroguanylin by tubular endoproteases because prouroguanylin is not detected in the urine. Studies of pathogenesis of colorectal cancer demonstrate that prouroguanylin may serve as marker of colon tumors in the body. Recent experiments also refer to possibility of prouroguanylin to play a significant role at diagnostic and treatment of heart diseases. Areas of investigation: Renal disease, Heart failure, Oncology
