Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

PTHrP Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Parathyroid Hormone-related Protein
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10279010 10 µg
RBG10279050 50 µg
RBG10279100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Amino Acid Sequence

AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP

Source

E. coli

Purity

98%

Biological Activity

Data not available.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in 1× PBS, pH 7.2 to a concentration of 0.1–0.5 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Bone and cartilage metabolism, Cardiovascular disease, Coronary artery disease

Summary

PTHrP is a polypeptide hormone produced by almost every tissue of the body. PTHrP is closely related to parathyroid hormone (PTH), which is secreted from the parathyroid gland and plays a central role in regulating the extracellular concentrations of calcium and phosphorous. Re­combinant human PTHrP is a 9.8 kDa linear polypeptide of 86 amino acid residues.

Related Products Docs