Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

R-Spondin-1 Human Chinese Hamster Ovary Cells (CHO)

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:Chinese Hamster Ovary Cells (CHO)
  • Other names:Roof plate-specific Spondin, Rspo1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10280005 5 µg
RBG10280020 20 µg
RBG10280100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

R-Spondin-1 (Rspo-1) belongs to the (Rspo) family of Wnt modulators. Currently, the family consists of four structurally related secreted ligands (Rspo 1–4), all containing the furin-like and thrombospondin structural domains. Rspo-1 is expressed in certain areas of the developing central nervous system, as well as in the adrenal glands, ovary, testis, thyroid, and trachea. Rspo can interact with the Frizzled/LRP6 receptor complex in a manner that stimulates the Wnt/beta-catenin signaling pathway. Recombinant Human R-Spondin-1 is a 26.7 kDa protein consisting of 243 amino acid residues. Due to glycosylation, R-Spondin-1 migrates at an apparent molecular weight of approximately 40.0 kDa by SDS-PAGE analysis under reducing conditions.

Amino Acid Sequence

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Source

Chinese Hamster Ovary Cells (CHO)

Purity

95%

Biological Activity

R-spondin-1 enhances BMP-2 mediated differentiation of MC3T3-E1 cells. The expected ED50 is 1.0–3.0 ug/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Neural tissue markers, Oncology

Related Products Docs