Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

RANTES Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Regulation upon Activation Normal T cell Express Sequence, CCL5, SIS-delta
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20114005 5 µg
RBG20114020 20 µg
RBG20114100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

RANTES is a CC chemokine that can signal through the CCR1, CCR3, CCR5 and US28 (cytomegalovirus receptor) receptors. It is a chemoattractant towards monocytes, memory T cells (CD4+/CD45RO), basophils, and eosinophils. RANTES also has the capability to inhibit certain strains of HIV-1, HIV-2 and simian immunodeficiency virus (SIV). Recombinant Murine RANTES is a 7.8 kDa protein containing 68 amino acid residues, including the four highly conserved cysteine residues present in the CC chemokines.

Amino Acid Sequence

SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract total human lymphocyte population and total murine T cell population using a concentration range of 1.0–10.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Chemokines, Coronary artery disease, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation, Neural tissue markers, Transplantation, Animal studies

Related Products Docs