Type
Recombinant protein
Description
Total 148 AA. MW: 17.4 kDa (calculated). UniProtKB acc.no. Q9BYZ8. N-Terminal His-tag 12 AA (highlighted).
Amino Acid Sequence
MKHHHHHHASHMDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Source
E. coli
Purity
>95%
SDS-PAGE Gel
12% SDS-PAGE separation of Human REGIV
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane
Endotoxin
< 0.1 EU/μg
Formulation
Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 20 mM Tris, 25 mM NaCl, pH 8.0
Reconstitution
Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
Applications
Western blotting, ELISA
Shipping
At ambient temperature. Upon receipt, store the product at the temperature recommended below.
Storage/Expiration
Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
LAL to determine quantity of endotoxin.
Note
This product is intended for research use only.
Research topic
Diabetology - Other Relevant Products, Immune Response, Infection and Inflammation, Oncology, Pancreatic regulatory molecules, Animal studies
Summary
Regenerating (Reg) gene family belongs to the calcium depending lectin gene super family. It represents a group of small, multi‑functional secreted proteins, which can function as acute phase reactants, lectins and anti‑apoptotic or growth agents. These agents play an important role in proliferation and differentiation in the entire GI tract. The Reg family consists of seven members in mice (Reg I, Reg II, Reg IIIa, Reg IIIb, Reg IIId and Reg IIIge and Reg IV). Four members are recognized in humans (Reg Ia, Reg Ib, Reg III and Reg IV), but there are most probably a few more. Reg genes are up‑regulated following tissue injury, and play a major role in the healing of gastrointestinal mucosal lesions. Different members of the Reg gene family were shown to be expressed in pancreatic, gastric and colorectal cancers, and may serve as markers for poor prognosis. Reg IV, a novel member of the family, was suggested to play an important role in initiating the multi‑step process of colorectal cancer carcinogenesis, at the level of adenoma, by increasing the resistance for programmed cell death. Regenerating gene family member 4 (REG4) was originally identified by sequencing of a cDNA library derived from patients with inflammatory bowel disease. It is located on chromosome 1, encoding 158 amino acids, including a signal peptide of 22 amino acids and a conserved calcium-dependent carbohydrate- recognition domain. Although REG4 is expressed in various normal tissues, the expression levels are much lower than in cancerous tissues. It is expressed not only in various normal tissues such as stomach, colon, small intestine and pancreas, but also in various malignant diseases, including colorectal, gastric, pancreatic and gallbladder cancer as well as in benign diseases such as ulcerative colitis.