Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Regenerating Protein 4 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Regenerating islet-derived protein 4, REG-4, Regenerating islet-derived protein IV, Reg IV, REG-like protein, Gastrointestinal secretory protein, REG4, GISP, RELP
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172083100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 148 AA. MW: 17.4 kDa (calculated). UniProtKB acc.no. Q9BYZ8. N-Terminal His-tag 12 AA (highlighted).

Amino Acid Sequence

MKHHHHHHASHMDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP

Source

E. coli

Purity

>95%

SDS-PAGE Gel

12% SDS-PAGE separation of Human REGIV
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 20 mM Tris , pH 8.0

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

Note

This product is intended for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Immune Response, Infection and Inflammation, Oncology, Pancreatic regulatory molecules, Animal studies

Summary

Regenerating (Reg) gene family belongs to the calcium depending lectin gene super family. It represents a group of small, multi‑functional secreted proteins, which can function as acute phase reactants, lectins and anti‑apoptotic or growth agents. These agents play an important role in proliferation and differentiation in the entire GI tract. The Reg family consists of seven members in mice (Reg I, Reg II, Reg IIIa, Reg IIIb, Reg IIId and Reg IIIge and Reg IV). Four members are recognized in humans (Reg Ia, Reg Ib, Reg III and Reg IV), but there are most probably a few more. Reg genes are up‑regulated following tissue injury, and play a major role in the healing of gastrointestinal mucosal lesions. Different members of the Reg gene family were shown to be expressed in pancreatic, gastric and colorectal cancers, and may serve as markers for poor prognosis. Reg IV, a novel member of the family, was suggested to play an important role in initiating the multi‑step process of colorectal cancer carcinogenesis, at the level of adenoma, by increasing the resistance for programmed cell death. Regenerating gene family member 4 (REG4) was originally identified by sequencing of a cDNA library derived from patients with inflammatory bowel disease. It is located on chromosome 1, encoding 158 amino acids, including a signal peptide of 22 amino acids and a conserved calcium-dependent carbohydrate- recognition domain. Although REG4 is expressed in various normal tissues, the expression levels are much lower than in cancerous tissues. It is expressed not only in various normal tissues such as stomach, colon, small intestine and pancreas, but also in various malignant diseases, including colorectal, gastric, pancreatic and gallbladder cancer as well as in benign diseases such as ulcerative colitis.

Summary References (10)

References to Regenerating Protein 4

  • Hartupee JC, Zhang H, Bonaldo MF, Soares MB, Dieckgraefe BK. Isolation and characterization of a cDNA encoding a novel member of the human regenerating protein family: Reg IV. Biochim Biophys Acta. 2001 Apr 16;1518(3):287-93.
  • He XJ, Jiang XT, Ma YY, Xia YJ, Wang HJ, Guan TP, Shao QS, Tao HQ. REG4 contributes to the invasiveness of pancreatic cancer by upregulating MMP-7 and MMP-9. Cancer Sci. 2012 Dec;103 (12):2082-91
  • Kinoshita Y, Ishihara S, Kadowaki Y, Fukui H, Chiba T. Reg protein is a unique growth factor of gastric mucosal cells. J Gastroenterol. 2004 Jun;39(6):507-13.
  • Li A, Crimmins DL, Luo Q, Hartupee J, Landt Y, Ladenson JH, Wilson D, Anant S, Dieckgraefe BK. Expression of a novel regenerating gene product, Reg IV, by high density fermentation in Pichia pastoris: production, purification, and characterization. Protein Expr Purif. 2003 Oct;31(2):197-206.
  • Numata M, Oshima T. Significance of regenerating islet-derived type IV gene expression in gastroenterological cancers. World J Gastroenterol. 2012 Jul 21;18 (27):3502-10
  • Pankova-Kholmyansky I, Arber N. Reg IV can serve for early diagnosis and therapy. Cancer Biol Ther. 2007 Jan;6 (1):123-4
  • Violette S, Festor E, Pandrea-Vasile I, Mitchell V, Adida C, Dussaulx E, Lacorte JM, Chambaz J, Lacasa M, Lesuffleur T. Reg IV, a new member of the regenerating gene family, is overexpressed in colorectal carcinomas. Int J Cancer. 2003 Jan 10;103(2):185-93.
  • Wang F, Xu L, Guo C, Ke A, Hu G, Xu X, Mo W, Yang L, Huang Y, He S, Wang X. Identification of RegIV as a novel GLI1 target gene in human pancreatic cancer. PLoS One. 2011;6 (4):e18434
  • Zhang Y, Lai M, Lv B, Gu X, Wang H, Zhu Y, Zhu Y, Shao L, Wang G. Overexpression of Reg IV in colorectal adenoma. Cancer Lett. 2003 Oct 8;200(1):69-76.
  • Zhang YW, Ding LS, Lai MD. Reg gene family and human diseases. World J Gastroenterol. 2003 Dec;9(12):2635-41
Related Products Docs