Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Regucalcin Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:RC, Gluconolactonase, GNL, EC=3.1.1.17, Senescence marker protein 30, SMP-30, RGN
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172257100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 309 AA. MW: 34.49 kDa (calculated). UniProtKB acc.no. Q15493. N-terminal His-tag (10 extra AA).

Amino Acid Sequence

MKHHHHHHASMSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG

Source

E. coli

Purity

Purity as determined by densitometric image analysis and GFC: > 95%

SDS-PAGE Gel

12% SDS-PAGE separation of Human Regucalcin:
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 2.5μg/lane
3. non-reduced and non-heated sample, 2.5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml in 20mM Tris buffer, 50mM NaCl, pH 9.0

Reconstitution

Add 200ul of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store lyophilized protein at –80°C. Lyophilized protein remains stable until the expiry date when stored at –80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Bone and cartilage metabolism, Neural tissue markers, Oncology

Related Products Docs