Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

RELM-alpha Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:RELM-alpha, Resistin-like alpha, RELMalpha Cysteine-rich secreted protein FIZZ1, Parasite-induced macrophage novel gene 1 protein, Cysteine-rich secreted protein A12-gamma, Retnla, Fizz1, Pmng1, hypoxia-induced mitogenic factor (HIMF)
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


New RBG20115005 5 µg
New RBG20115025 25 µg
New RBG20115100 100 µg
PubMed Product Details
Technical Data

Type

Recombinant protein

Amino Acid Sequence

MDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDW TTARCCQLS

Source

E. coli

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Formulation

Sterile filtered through a 0.2 micron filter. Lyophilized from 10 mM Tris, pH 7.5 + 25 mM NaCl.

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to -80°.C.

Storage/Expiration

 –20°C

Summary

Research topic

Energy metabolism and body weight regulation

Summary

Bronchoalveolar lavage fluid from mice with experimentally induced allergic pulmonary inflammation contains a novel 9.4 kDa cysteine-rich secreted protein, RELM-alpha (FIZZ1, found in inflammatory zone). RELM-alpha is a secreted protein that has a restricted tissue distribution with highest levels in adipose tissue stroma. Murine RELM-alpha (FIZZ1) is the founding member of a new gene family including two other murine genes expressed, respectively, in intestinal crypt epithelium (RELM-beta) and white adipose tissue (Resistin), and two related human genes. RELMalpha inhibits the differentiation of 3T3-L1 preadipocytes into adipocytes but has no effect on proliferation of 3T3-L1 preadipocytes. RELMalpha is able to form heterooligomers with resistin but not RELMbeta. Since RELMalpha is expressed by adipose tissue and it is a secreted factor, our findings suggest that RELMalpha may be involved in the control of the adipogenesis as well as in the process of muscle differentiation. In the lung, RELM-alpha is induced by hypoxia and was renamed as hypoxia-induced mitogenic factor (HIMF). HIMF strongly activated Akt phosphorylation. The phosphatidylinositol 3-kinase (PI3K) inhibitor LY294002 (10 micromol/L) inhibited HIMF-activated Akt phosphorylation. It also inhibited HIMF stimulated RPSM proliferation. Thus, the PI3K/Akt pathway, at least in part, mediates the proliferative effect of HIMF. Further studies showed that HIMF had angiogenic and vasoconstrictive properties. HIMF increased pulmonary arterial pressure and vascular resistance. Further studies suggest that HIMF regulates apoptosis and may participate in lung alveolarization and maturation.

References to Summary

References to Resistin-Like Molecule-alpha

  • Banerjee RR, Lazar MA. Dimerization of resistin and resistin-like molecules is determined by a single cysteine. J Biol Chem. 2001 Jul 13;276 (28):25970-3
  • Bing C, Gomez-Ambrosi J, Zabalegui N, Williams G, Trayhurn P. Resistin and RELM-alpha gene expression in white adipose tissue of lactating mice. Biochem Biophys Res Commun. 2002 Aug 16;296 (2):458-62
  • Miner JL. The adipocyte as an endocrine cell. J Anim Sci. 2004 Mar;82 (3):935-41
  • Wang ML, Shin ME, Knight PA, Artis D, Silberg DG, Suh E, Wu GD. Regulation of RELM/FIZZ isoform expression by Cdx2 in response to innate and adaptive immune stimulation in the intestine. Am J Physiol Gastrointest Live. 2005 May;288 (5):G1074-83
  • Yang RZ, Huang Q, Xu A, McLenithan JC, Eisen JA, Shuldiner AR, Alkan S, Gong DW. Comparative studies of resistin expression and phylogenomics in human and mouse. Biochem Biophys Res Commun. 2003 Oct 24;310 (3):927-35
Related Products Documents