Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

RELMβ Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Resistin-like ß, Cysteine-rich secreted protein FIZZ2
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20116005 5 µg
RBG20116025 25 µg
RBG20116100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

RELMβ (Resistin-like molecule β/FIZZ2) is a disulfide-linked, homodimeric protein expressed in the epithelium of the colon and small bowel. The biological functions of RELMβ, and its molecular targets, are not fully known, but it has been suggested that it plays a regulatory role during inflammation, and may also act to establish links among adipose tissue, the intestine and the liver. Interestingly, the molecular structure of RELMβ is highly homologous to that of the adipose-derived cytokines, resistin and RELMα. These proteins share a highly conserved C-terminal domain, characterized by 10 cysteine residues with a unique spacing motif of C-X11-C-X8-C-X-C-X3-C-X10-C-X-C-X-C-X9-C-C. Recombinant Murine RELMβ is an 18.0 kDa protein, consisting of two identical 83 amino acid polypeptide chains linked by a single disulfide bond.

Amino Acid Sequence

MQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA

Source

E. coli

Purity

98%

Biological Activity

Data not available.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Immune Response, Infection and Inflammation, Animal studies

Related Products Docs