Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Renalase Human E.coli

  • Regulatory status:RUO
  • Type:Recombinant
  • Source:E. coli
  • Other names:Monoamine oxidase-C, MAO-C
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RD172123100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant

Description

Total 335 AA. MW: 37.5 kDa (calculated). UniProtKB acc.no. Q5VYX0 (Ala18-Ile342). N-terminal His-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASALLRRQTSGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLH HKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 95%

SDS-PAGE Gel

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0.4 μm) and frozen from 0.3-0.5 mg/ml solution in 15 mM Tris, 85 mM glycine, 20%(w/v) glycerol, pH 8.5

Reconstitution

Defrost at ambient temperature

Applications

Western blotting, ELISA

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for three days.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Summary

Renalase is a flavin adenin dinucleotide-dependent amine oxidase that is secreted by the kidney, circulates in the blood, and modulates cardiac function and systemic blood pressure. It exists in humans in seven isoforms, which show tissue specificity.

References to Summary

References to Renalase

  • Velazquez H, Crowley S, Desir GV, Peixoto A, Xu J, Li G, Yao X, Li Y, Wu Y. Renalase is a novel, soluble monoamine oxidase that regulates cardiac function and blood pressure. The Journal of Clinical Investigation 2005 May 115: 1275-1280
  • Zhao Q, Fan Z, He J, Chen S, Li H, Zhang P, Wang L, Hu D, Huang J, Qiang B, Gu D. Renalase gene is a novel susceptibility gene for essential hypertension: a two-stage association study in northern Han Chinese population. J.Mol.Med 2007 Aug, 85(8): 877-885
  • Boosma E, Tipton KF. Renalase, a catecholamine-metabolising enzyme? J.Neural Transm 2007 Mar, 114(6): 775-776
  • Zbroch E, Malyszko J, Malyszko JS, Koc-Zoravska E. Mysliwiec M. Renalase, a novel enzyme involved in blood pressure regulation, is related to kidney function but not to blood pressure in hemodialysis patients. Kidney Blood Press Res 2012 Apr, 35: 395-399
  • Beaupre BA, Carmichael BR, Hoag MR, Shah DD, Moran GR. Renalase is an alpha-NAD(P)H oxidase/anomerase. J.Am. Chem. Soc. 2013 Aug, 135(37):13980-13987
  • Musialowska D, Malyszko J. Renalase - a new marker or just a bystander in cardiovascular disease: clinical and experimental data. Kardiol Pol. 2016 Jun, 74(9) 937-942 Stec A. Rs10887800 renalase gene polymorphism influences the level of circulating renalase in patients undergoing hemodialysis but not in healthy controls. BMC Nephrol. 2017 Apr, 18(1) 118
Related Products
Documents