Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

Prorenin Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293
  • Other names:Angiotensinogenase, REN
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172167100-HEK 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 393 AA. MW: 43.7 kDa (calculated). UniProtKB acc. No. P00797 (Leu24–Arg406). C-terminal His-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARHHHHHHHHHH

Source

HEK293

Purity

Purity as determined by densitometric image analysis: > 95%

SDS-PAGE Gel

12 % SDS-PAGE separation of Human Renin (HEK):
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. Reduced and boiled sample, 2.5 μg/lane
3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 0.1 EU/μg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in phosphate buffered saline + 5% (w/v) trehalose.

Reconstitution

Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA, Cell culture and/or animal studies

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Blood pressure regulation and NO metabolism, Cardiovascular disease, Diabetology - Other Relevant Products, Renal disease

Summary

Renin , a polypeptidic enzyme (MW~ 40000) also known as angiotensinogenase, is a circulating protease secreted by juxtaglomerular cells in the juxtaglomerular apparatus of the kidneys in response to low blood volume or low body NaCL content. Renin activates the renin-angiotensin system by cleaving angiotensinogen produced in the liver into angiotensin I (inactive) which is further converted into angiotensin II (active) in the vascular epithelium of the lung. Angiotensin II can cause vasoconstriction by stimulating the central nervous system , in addition it stimulates ADH (antidiuretic hormone) secretion and aldosterone secretion from the adrenal gland.Regulation of blood pressure and renal glomerular filtration control are the most important functions of renin -angiotensin system . Plasmatic concentration of renin is influenced by concentration of circulating angiotensinogen and subsequently the concentration of angiotensin II. High plasmatic levels of angiotensin II reduce renin secretion.(negative feed back) Determination of renin plasma levels is useful in the diagnosis of hypertension and in the therapeutic follow up of hypertensive patients. Plasmatic concentration of renin decreases in patients with hypertension due to a primary hyperaldosteronism , contrary to renovascular hypertension where concentrations of renin and aldosterone are both elevated.

Summary References (24)

References to Renin

  • Atlas SA. The renin-angiotensin aldosterone system: pathophysiological role and pharmacologic inhibition. J Manag Care Pharm. 2007 Oct;13 (8 Suppl B):9-20
  • Brossaud J, Corcuff JB. Pre-analytical and analytical considerations for the determination of plasma renin activity. Clin Chim Acta. 2009 Dec;410 (1-2):90-2
  • Bystrom CE, Salameh W, Reitz R, Clarke NJ. Plasma renin activity by LC-MS/MS: development of a prototypical clinical assay reveals a subpopulation of human plasma samples with substantial peptidase activity. Clin Chem. 2010 Oct;56 (10):1561-9
  • Campbell DJ. Circulating and tissue angiotensin systems. J Clin Invest. 1987 Jan;79 (1):1-6
  • Campbell DJ, Nussberger J, Stowasser M, Danser AH, Morganti A, Frandsen E, Menard J. Activity assays and immunoassays for plasma Renin and prorenin: information provided and precautions necessary for accurate measurement. Clin Chem. 2009 May;55 (5):867-77
  • Cartledge S, Lawson N. Aldosterone and renin measurements. Ann Clin Biochem. 2000 May;37 ( Pt 3):262-78
  • Catena C, Colussi G, Nadalini E, Chiuch A, Baroselli S, Lapenna R, Sechi LA. Relationships of plasma renin levels with renal function in patients with primary aldosteronism. Clin J Am Soc Nephrol. 2007 Jul;2 (4):722-31
  • Chawla T, Sharma D, Singh A. Role of the renin angiotensin system in diabetic nephropathy. World J Diabetes. 2010 Nov 15;1 (5):141-5
  • Derkx FH, Schalekamp MP, Schalekamp MA. Two-step prorenin-renin conversion. Isolation of an intermediary form of activated prorenin. J Biol Chem. 1987 Feb 25;262 (6):2472-7
  • Distler A, Spies KP. Diagnostic procedure in renovascular hypertension. Clin Nephrol. 1991 Oct;36 (4):174-80
  • Doi SA, Abalkhail S, Al-Qudhaiby MM, Al-Humood K, Hafez MF, Al-Shoumer KA. Optimal use and interpretation of the aldosterone renin ratio to detect aldosterone excess in hypertension. J Hum Hypertens. 2006 Jul;20 (7):482-9
  • Glinicki P, Jeske W, Bednarek-Papierska L, Kruszynska A, Gietka-Czernel M, Roslonowska E, Slowinska-Srzednicka J, Kasperlik-Zaluska A, Zgliczynski W. The ratios of aldosterone / plasma renin activity (ARR) versus aldosterone / direct renin concentration (ADRR). J Renin Angiotensin Aldosteron. 2015 Dec;16 (4):1298-305
  • Hall JE. Control of glomerular filtration rate by rennin-angiotensin system . Am.J.Physiol. 1977;233(5) :F366-F372
  • Hardman JA, Hort YJ, Catanzaro DF, Tellam JT, Baxter JD, Morris BJ, Shine J. Primary structure of the human renin gene. DNA. 1984 Dec;3 (6):457-68
  • Hartman D, Sagnella GA, Chesters CA, Macgregor GA. Direct renin assay and plasma renin activity assay compared. Clin Chem. 2004 Nov;50 (11):2159-61
  • Ichihara A, Sakoda M, Kurauchi-Mito A, Kaneshiro Y, Itoh H. Renin, prorenin and the kidney: a new chapter in an old saga. J Nephrol. 2009 May-Jun;22 (3):306-11
  • Lim PO, Jung RT, MacDonald TM. Raised aldosterone to renin ratio predicts antihypertensive efficacy of spironolactone: a prospective cohort follow-up study. Br J Clin Pharmacol. 1999 Nov;48 (5):756-60
  • Montecucco F, Pende A, Mach F. The renin-angiotensin system modulates inflammatory processes in atherosclerosis: evidence from basic research and clinical studies. Mediators Inflamm. 2009;2009:752406
  • Mulatero P, Verhovez A, Morello F, Veglio F. Diagnosis and treatment of low-renin hypertension. Clin Endocrinol (Oxf). 2007 Sep;67 (3):324-34
  • Pacurari M, Kafoury R, Tchounwou PB, Ndebele K. The Renin-Angiotensin-aldosterone system in vascular inflammation and remodeling. Int J Inflam. 2014;2014:689360
  • Paul M, Poyan Mehr A, Kreutz R. Physiology of local renin-angiotensin systems. Physiol Rev. 2006 Jul;86 (3):747-803
  • Pratt RE, Carleton JE, Richie JP, Heusser C, Dzau VJ. Human renin biosynthesis and secretion in normal and ischemic kidneys. Proc Natl Acad Sci U S A. 1987 Nov;84 (22):7837-40
  • Reudelhuber TL. Prorenin, Renin, and their receptor: moving targets. Hypertension. 2010 May;55 (5):1071-4
  • Ruster C, Wolf G. Renin-angiotensin-aldosterone system and progression of r
Related Products Docs