Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Resistin-Like Molecule-gamma Mouse E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:RELM-gamma, Resistin like gamma, Retnlg, retn1g
  • Species:Mouse
Please select your region to see available products and prices.
Cat. No. Size Price


RD272082100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 102 AA. MW: 11 kDa (calculated). UniProtKB acc.no. Q7TM98. N-Terminal His-tag 16 AA (highlighted).

Amino Acid Sequence

MRGSHHHHHHGMASHMTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA

Source

E. coli

Purity

>95%

SDS-PAGE Gel

12% SDS-PAGE separation of Mouse RELM gamma
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 10μg/lane
3. non-reduced and non-heated sample, 10μg/lane

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 0.05M Acetate buffer pH 4

Reconstitution

Add 0.1M Acetate buffer pH4 to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/mL. In higher concentrations the solubility of this antigen is limited. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

Note

This product is intended for research use only.

Summary

Research topic

Energy metabolism and body weight regulation, Animal studies

Summary References (1)

References to Resistin-Like Molecule-gamma

  • Wang ML, Shin ME, Knight PA, Artis D, Silberg DG, Suh E, Wu GD. Regulation of RELM/FIZZ isoform expression by Cdx2 in response to innate and adaptive immune stimulation in the intestine. Am J Physiol Gastrointest Live. 2005 May;288 (5):G1074-83
Related Products Docs