Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Resistin Rat E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Cysteine-rich secreted protein FIZZ3, Adipose tissue-specific secretory factor, ADSF, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein A12-alpha-like 2, RETN, FIZZ3, HXCP1, RSTN, UNQ407/PRO1199
  • Species:Rat
Please select your region to see available products and prices.
Cat. No. Size Price


RBG30072005 5 µg
RBG30072025 25 µg
RBG30072100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Resistin belongs to a family of tissue-specific cytokines termed FIZZ (found in inflammatory zones) and RELM. The four known members of this family, resistin, RELMα, RELMβ, and RELMγ, share a highly conserved C-terminal domain, characterized by 10 cysteine residues with a unique spacing motif of C-X11-C-X8-C-X-C-X3-C-X10-C-X-C-X-C-X9-C-C. Resistin is an adipose-derived cytokine (adipokine) whose physiological function and molecular targets are largely unknown. Studies have shown that resistin suppresses insulin's ability to stimulate glucose uptake, and postulated that resistin might be an important link between obesity and Type 2 diabetes. Other studies have indicated that resistin expression is severely suppressed in obesity, and that it may act as a feedback regulator of Adipogenesis. Recombinant Rat Resistin is a 20.0 kDa, disulfide-linked, homodimeric protein composed of two 94 identical amino acid chains linked by a single disulfide bond.

Amino Acid Sequence

PSMSLCPMDEAISKKINQDFSSLLPAAMKNTVLHCWSVSSRGRLASCPEGTTVTSCSCGSGCGSWDVREDTMCHCQCGSIDWTAARCCTLRVGS

Source

E. coli

Purity

97%

Biological Activity

Data not available.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Diabetology - Other Relevant Products, Energy metabolism and body weight regulation, Animal studies

Summary

Resistin, a product of the RSTN gene, is a peptide hormone belonging to the class of cysteine-rich secreted proteins which is termed the RELM family, and is also described as ADSF (Adipose Tissue-Specific Secretory Factor) and FIZZ3 (Found in Inflammatory Zone). Human resistin contains 108 amino acids as a prepeptide, and its hydrofobic signal peptide is cleaved before its secretion. Resistin circulates in human blood as a dimeric protein consisting of two 92 amino acid polypeptides, which are disulfide-linked via Cys26. Resistin may be an important link between obesity and insulin resistance. Mouse resistin, specifically produced and secreted by adipocyte, acts on skeletal muscle myocytes, hepatocytes and adipocytes themselves so that it reduces their sensitivity to insulin. Steppan et al. have suggested that resistin suppresses the ability of insulin to stimulace glucose uptake. They have also suggested that resistin is present at elevated levels in blood of obese mice, and is down regulated by fasting and antidiabetic drugs. Way et al., on the other hand, have found that resistin expression is severly suppressed in obesity and is stimulated by several antidiabetic drugs. Other studies have shown that mouse resistin increases during the differentiation of adipocytes, but it also seems to inhibit adipogenesis. In contrast, the human adipogenic differentiation is likely to be associated with a down regulation of resistin gene expression. Recent studies have shown that human resistin is expressed also in macrophages and may be a novel link between inflammation and insulin resistance.

Summary References (21)

References to Resistin

  • Banerjee RR, Lazar MA. Dimerization of resistin and resistin-like molecules is determined by a single cysteine. J Biol Chem. 2001 Jul 13;276 (28):25970-3
  • Bokarewa M, Nagaev I, Dahlberg L, Smith U, Tarkowski A. Resistin, an adipokine with potent proinflammatory properties. J Immunol. 2005 May 1;174 (9):5789-95
  • Fasshauer M, Klein J, Neumann S, Eszlinger M, Paschke R. Tumor necrosis factor alpha is a negative regulator of resistin gene expression and secretion in 3T3-L1 adipocytes. Biochem Biophys Res Commun. 2001 Nov 9;288 (4):1027-31
  • Fasshauer M, Paschke R. Regulation of adipocytokines and insulin resistance. Diabetologia. 2003 Dec;46 (12):1594-603
  • Gong H, Ni Y, Guo X, Fei L, Pan X, Guo M, Chen R. Resistin promotes 3T3-L1 preadipocyte differentiation. Eur J Endocrinol. 2004 Jun;150 (6):885-92
  • Hartman HB, Hu X, Tyler KX, Dalal CK, Lazar MA:. Mechanisms Regulating Adipocyte Expression of Resistin. J Biol Chem. 277, 19754-19761, (2002) .
  • Juan CC, Au LC, Fang VS, Kang SF, Ko YH, Kuo SF, Hsu YP, Kwok CF, Ho LT. Suppressed gene expression of adipocyte resistin in an insulin-resistant rat model probably by elevated free fatty acids. Biochem Biophys Res Commun. 2001 Dec 21;289 (5):1328-33
  • Kershaw EE, Flier JS. Adipose tissue as an endocrine organ. J Clin Endocrinol Metab. 2004 Jun;89 (6):2548-56
  • Kim KH, Lee K, Moon YS, Sul HS. A cysteine-rich adipose tissue-specific secretory factor inhibits adipocyte differentiation. J Biol Chem. 2001 Apr 6;276 (14):11252-6
  • Maebuchi M, Machidori M, Urade R, Ogawa T, Moriyama T:. Low resistin levels in adipose tissues and serum high-fat fed mice and genetically obese mice: development of an ELISA system for quantification of resistin. Archiv Biochem Biophys. 416, 164-170 (2003) .
  • Malo E, Ukkola O, Jokela M, Moilanen L, Kahonen M, Nieminen MS, Salomaa V, Jula A, Kesaniemi YA. Resistin is an indicator of the metabolic syndrome according to five different definitions in the Finnish Health 2000 survey. Metab Syndr Relat Disord. 2011 Jun;9 (3):203-10
  • Meier U, Gressner AM. Endocrine regulation of energy metabolism: review of pathobiochemical and clinical chemical aspects of leptin, ghrelin, adiponectin, and resistin. Clin Chem. 2004 Sep;50 (9):1511-25
  • Milan G, Granzotto M, Scarda A, Calcagno A, Pagano C, Federspil G, Vettor R. Resistin and adiponectin expression in visceral fat of obese rats: effect of weight loss. Obes Res. 2002 Nov;10 (11):1095-103
  • Nogueiras R, Gallego R, Gualillo O, Caminos JE, Garcia-Caballero T, Casanueva FF, Dieguez C. Resistin is expressed in different rat tissues and is regulated in a tissue- and gender-specific manner. FEBS Lett. 2003 Jul 31;548 (1-3):21-7
  • Pravenec M, Kazdová L, Landa V, Zídek V, Mlejnek P, Jansa P, Wang J, Qi N, Kurtz TW:. Transgenic and recombinant resistin impair skeletal muscle glucose metabolism in the spontaneously hypertensive rat. J Biol Chem. 278, 45209-45215, (2001) .
  • Rajala MW, Obici S, Scherer PE, Rossetti L. Adipose-derived resistin and gut-derived resistin-like molecule-beta selectively impair insulin action on glucose production. J Clin Invest. 2003 Jan;111 (2):225-30
  • Sadashiv, Tiwari S, Paul BN, Kumar S, Chandra A, Dhananjai S, Negi MP. Over expression of resistin in adipose tissue of the obese induces insulin resistance. World J Diabetes. 2012 Jul 15;3 (7):135-41
  • Satoh H, Nguyen MT, Miles PD, Imamura T, Usui I, Olefsky JM. Adenovirus-mediated chronic "hyper-resistinemia" leads to in vivo insulin resistance in normal rats. J Clin Invest. 2004 Jul;114 (2):224-31
  • Steppan CM, Bailley ST, Brown EJ, Banerjee RR, Wright CM, Patel HR, Ahima RS, Lazar MA:. The Hormone Links Obesity to Diabetes. Nature. 409, 307-312, (2001) .
  • Steppan CM, Brown EJ, Wright CM, Bhat S, Banerjee RR, Dai CY, Enders GH, Silberg DG, Wen X, Wu GD, Lazar MA:. A Family of Tissue-specific Resistin-like Molecules. PNAS. 98, 502-506, (2001) .
  • Steppan CM, Lazar MA. The current biology of resistin. J Intern Med. 2004 Apr;255 (4):
Related Products Docs