Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

S100A10 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:S100 calcium-binding protein A10, Calpactin I light chain, p10 protein, p11, Cellular ligand of annexin II, ANX2LG, CAL1L, CLP11
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172219100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 106 AA. MW: 12.31 kDa (calculated). UniProtKB acc.no. P60903. N-Terminal His-tag, 10 extra AA (highlighted).

Amino Acid Sequence

MKHHHHHHASPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Source

E. coli

SDS-PAGE Gel

14% SDS-PAGE separation of Human S100A10 protein
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg / lane
3. non-reduced and non-heated sample, 5μg / lane

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 20mM TRIS, 50mM NaCl, pH 7.5

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

Summary

Research topic

Cardiovascular disease, Others

Related Products Docs