Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

S100A11 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:S100 calcium-binding protein A11, Protein S100-C, Calgizzarin Metastatic lymph node gene 70 protein, MLN70, S100C
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172220100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 115 AA. MW: 12,98 kDa (calculated). UniProtKB acc.no. P31949. N-Terminal His-tag, 10 extra AA (highlighted).

Amino Acid Sequence

MKHHHHHHASMAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Source

E. coli

SDS-PAGE Gel

14% SDS-PAGE separation of Human S100A11 protein
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg / lane
3. non-reduced and non-heated sample, 5μg / lane

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 20mM TRIS, 50mM NaCl, pH 7.5

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

Summary

Research topic

Cardiovascular disease, Immune Response, Infection and Inflammation, Oncology, Others

Summary

S100A11 (S100C; calgizzarin) was first isolated from chicken gizzard smooth muscle. Human homologue was later identified in human colorectal cancer cells and in colorectal normal mucosa, with much higher expression in the cancer cells. S100A11 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. The polypeptide chain consists of 105 amino acid residues giving molecular weight of unmodified monomeric protein 11.74 kDa. Disulphide bridge linking two monomers in the dimer via Cys-11 residues was found in its structure. The protein can be phosphorylated on some residues from which at least phosphorylation on Thr-10 causes significant structural changes. S100A11 binds to annexins A1 and A2, the DNA-dependent ATPase Rad54B, p53 and RAGE. It was proposed that up-regulated chondrocyte expression of S100A11 (as RAGE ligand) in OA cartilage and RAGE signaling through the p38 MAPK pathway promote inflammation-associated chondrocyte hypertrophy. RAGE signaling mediated by S100A11 thereby might have the potential to contribute to the progression of OA. S100A11 has also been shown to be secreted and to exert RAGE dependent signaling in human keratinocytes. S100A11 was found in many different human both normal and cancer tissues. S100A11 appears to play distinct roles depending on the tumour involved. In bladder carcinoma or renal carcinoma expression is related to tumour suppression however in prostate cancer, breast and pancreatic cancer S100A11 is thought to be a tumour promoter. S100A11 has been also indicated as one of potential biomarkers of infective endocarditis.

Product References (1)

References

  • Andrés Cerezo L, Šumová B, Prajzlerová K, Veigl D, Damgaard D, Nielsen CH,Pavelka K, Vencovský J, Šenolt L. Calgizzarin (S100A11): a novel inflammatorymediator associated with disease activity of rheumatoid arthritis. Arthritis Res Ther. 2017 Apr 26;19(1):79. doi: 10.1186/s13075-017-1288-y. PubMed PMID:28446208; PubMed Central PMCID: PMC5405489. See more on PubMed
Summary References (13)

References to S100A11

  • Cecil DL, Johnson K, Rediske J, Lotz M, Schmidt AM, Terkeltaub R. Inflammation-induced chondrocyte hypertrophy is driven by receptor for advanced glycation end products. J Immunol. 2005 Dec 15;175 (12):8296-302
  • Cross SS, Hamdy FC, Deloulme JC, Rehman I. Expression of S100 proteins in normal human tissues and common cancers using tissue microarrays: S100A6, S100A8, S100A9 and S100A11 are all overexpressed in common cancers. Histopathology. 2005 Mar;46 (3):256-69
  • Kondo A, Sakaguchi M, Makino E, Namba M, Okada S, Huh NH. Localization of S100C immunoreactivity in various human tissues. Acta Med Okayama. 2002 Feb;56 (1):31-4
  • Kouno T, Mizuguchi M, Sakaguchi M, Makino E, Mori Y, Shinoda H, Aizawa T, Demura M, Huh NH, Kawano K. The structure of S100A11 fragment explains a local structural change induced by phosphorylation. J Pept Sci. 2008 Oct;14 (10):1129-38
  • Leclerc E, Fritz G, Vetter SW, Heizmann CW. Binding of S100 proteins to RAGE: an update. Biochim Biophys Acta. 2009 Jun;1793 (6):993-1007
  • Memon AA, Sorensen BS, Meldgaard P, Fokdal L, Thykjaer T, Nexo E. Down-regulation of S100C is associated with bladder cancer progression and poor survival. Clin Cancer Res. 2005 Jan 15;11 (2 Pt 1):606-11
  • Ohuchida K, Mizumoto K, Ohhashi S, Yamaguchi H, Konomi H, Nagai E, Yamaguchi K, Tsuneyoshi M, Tanaka M. S100A11, a putative tumor suppressor gene, is overexpressed in pancreatic carcinogenesis. Clin Cancer Res. 2006 Sep 15;12 (18):5417-22
  • Rehman I, Azzouzi AR, Cross SS, Deloulme JC, Catto JW, Wylde N, Larre S, Champigneuille J, Hamdy FC. Dysregulated expression of S100A11 (calgizzarin) in prostate cancer and precursor lesions. Hum Pathol. 2004 Nov;35 (11):1385-91
  • Rety S, Osterloh D, Arie JP, Tabaries S, Seeman J, Russo-Marie F, Gerke V, Lewit-Bentley A. Structural basis of the Ca(2+)-dependent association between S100C (S100A11) and its target, the N-terminal part of annexin I. Structure. 2000 Feb 15;8 (2):175-84
  • Sakaguchi M, Sonegawa H, Murata H, Kitazoe M, Futami J, Kataoka K, Yamada H, Huh NH. S100A11, an dual mediator for growth regulation of human keratinocytes. Mol Biol Cell. 2008 Jan;19 (1):78-85
  • Tanaka M, Adzuma K, Iwami M, Yoshimoto K, Monden Y, Itakura M. Human calgizzarin; one colorectal cancer-related gene selected by a large scale random cDNA sequencing and northern blot analysis. Cancer Lett. 1995 Mar 2;89 (2):195-200
  • Thuny F, Textoris J, Amara AB, Filali AE, Capo C, Habib G, Raoult D, Mege JL. The gene expression analysis of blood reveals S100A11 and AQP9 as potential biomarkers of infective endocarditis. PLoS One. 2012;7 (2):e31490
  • Todoroki H, Kobayashi R, Watanabe M, Minami H, Hidaka H. Purification, characterization, and partial sequence analysis of a newly identified EF-hand type 13-kDa Ca(2+)-binding protein from smooth muscle and non-muscle tissues. J Biol Chem. 1991 Oct 5;266 (28):18668-73
Related Products Docs