Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

S100A4 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Calvasculin, Metastasin, Placental calcium-binding protein, S100 calcium-binding protein A4, CAPL, MTS1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172211100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 110 AA. MW: 12.84 kDa (calculated). UniProtKB acc.no. P26447. N-Terminal His-tag, 10 extra AA (highlighted).

Amino Acid Sequence

MKHHHHHHASACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Source

E. coli

SDS-PAGE Gel

12% SDS-PAGE separation of Human S100A4 protein
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 5μg / lane
3. non-reduced and non-boiled sample, 5μg / lane

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 20mM TRIS, 50mM NaCl, pH 7.5

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store lyophilized protein at –80°C. Lyophilized protein remains stable until the expiry date when stored at –80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

Summary

Research topic

Cardiovascular disease, Immune Response, Infection and Inflammation, Oncology

Related Products Docs