Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

S100A8 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:S100 calcium-binding protein A8, Calgranulin-A, Migration inhibitory factor-related protein 8, MRP-8, p8, Cystic fibrosis antigen, CFAG, Leukocyte L1 complex light chain, Calprotectin L1L subunit, Urinary stone protein band A, S100A8, CAGA, CFAG, MRP8
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172217100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 103 AA. MW: 12.08 kDa (calculated). UniProtKB acc.no. P05109. N-Terminal His-tag, 10 extra AA.

Amino Acid Sequence

MKHHHHHHASMLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

14% SDS-PAGE separation of Human S100A8 protein
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg / lane
3. non-reduced and non-heated sample, 5μg / lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 20mM TRIS, 100mM NaCl, pH 8.0

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at -80 °C. Lyophilized protein remains stable until the expiry date when stored at -80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein. LAL to determine quantity of endotoxin.

Summary

Research topic

Immune Response, Infection and Inflammation, Oncology, Pulmonary diseases, Sepsis

Summary

S100A8 and S100A9 belong to a family of 25 homologous low-molecular-weight intracellular calcium-binding proteins that exhibit tissue and cell-specific expression. They are characterized by two distinct EF-hand (helix-loop-helix) calcium-binding domains connected by a hinge region. The N-terminal Ca2+ binding domain has lower affinity than the canonical C-terminal domain that allows for functionally important second messenger roles dependent on intracellular Ca2+ levels. Human S100A8 (also known as MRP8, calgranulin A, L1 light chain, cystic fibrosis antigen) is the most closely related member of the human (h) S100 family to mS100A8, although the level of homology is low (69% at the DNA level; 58% at the amino acid level). Human S100A8 is a calcium-binding protein member of the S100 protein family, is highly expressed in the cytosol of neutrophils and monocytes, and is frequently found at high levels in the extracellular milieu during inflammatory conditions. S100A8 is almost exclusively expressed by cells of myeloid lineage and is constitutively expressed in the cytosol of neutrophils. Monocytes and differentiated macrophages from inflamed tissues also express S100A8. Increased serum levels of the S100A8 (MRP-8) protein have been reported in inflammatory conditions including bacterial infection, arthritis, and cystic fibrosis (CF). Preferentially exists as a heterodimer or heterotetramer with S100A9 known as calprotectin (S100A8/A9). Calprotectin (S100A8/9) is predominantly expressed in myeloid cells. Except for inflammatory conditions, the expression is restricted to a specific stage of myeloid differentiation since both proteins are expressed in circulating neutrophils and monocytes but are absent in normal tissue macrophages and lymphocytes. Under chronic inflammatory conditions, such as psoriasis and malignant disorders, also expressed in the epidermis. Found in high concentrations at local sites of inflammation or in the serum of patients with inflammatory diseases such as rheumatoid, cystic fibrosis, inflammatory bowel disease, Crohn's disease, giant cell arteritis, cystic fibrosis, Sjogren's syndrome, systemic lupus erythematosus, and progressive systemic sclerosis. Involved in the formation and deposition of amyloids in the aging prostate known as corpora amylacea inclusions. Strongly up-regulated in many tumors, including gastric, esophageal, colon, pancreatic, bladder, ovarian, thyroid, breast and skin cancers.

Summary References (4)

References to S100A8

  • Chung TH, Oh JS, Lee YS, Kang KS, Jung JW, Youn HY, Hwang CY. Elevated serum levels of S100 calcium binding protein A8 (S100A8) reflect disease severity in canine atopic dermatitis. J Vet Med Sci. 2010 Jun;72 (6):693-700
  • Henke MO, Renner A, Rubin BK, Gyves JI, Lorenz E, Koo JS. Up-regulation of S100A8 and S100A9 protein in bronchial epithelial cells by lipopolysaccharide. Exp Lung Res. 2006 Sep;32 (8):331-47
  • Passey RJ, Xu K, Hume DA, Geczy CL. S100A8: emerging functions and regulation. J Leukoc Biol. 1999 Oct;66 (4):549-56
  • Srikrishna G. S100A8 and S100A9: new insights into their roles in malignancy. J Innate Immun. 2012;4 (1):31-40
Related Products Docs