Type
Recombinant protein
Description
Total 123 AA. MW: 14.35 kDa (calculated). UniProtKB acc.no. P06702. N-Terminal His-tag, 10 extra AA (highlighted).
Amino Acid Sequence
MKHHHHHHASTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Source
E. coli
Purity
Purity as determined by densitometric image analysis: >90%
SDS-PAGE Gel
14% SDS-PAGE separation of Human S100A9
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane
Endotoxin
< 0.1 EU/µg
Formulation
Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 20mM TRIS, 50mM NaCl, pH 7.5
Reconstitution
Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
Applications
Western blotting
Shipping
At ambient temperature. Upon receipt, store the product at the temperature recommended below.
Storage/Expiration
Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
LAL to determine quantity of endotoxin.
Note
This product is intended for research use only.
Research topic
Coronary artery disease, Immune Response, Infection and Inflammation, Pulmonary diseases, Sepsis
Summary
S100A9 is a calcium binding protein. Each S100A9 monomer contains a high affinity calcium binding site at the C-terminus and a low-affinity calcium binding site at the N-terminus. S100A9 may exist as a homodimer, heterodimer with an S100A8 partner (S100A8/A9), or as a heterotetramer with an S100A8 partner (S100A8/A9). S100A9 was first identified in the context of multiple inflammatory reactions which has led to confusing nomenclature in the literature. In 1987, it was found in infiltrating macrophages of rheumatoid arthritis patients and named MRP-14 (myeloid related protein of molecular weight 14 kD). S100A9, a the member of the calcium binding S100 protein family that is also known as MRP14 or Calgranulin B, is an inflammation-associated protein that is constitutively expressed in neutrophils and inducible in numerous inflammatory cells, including macrophages, epithelial cells, and keratinocytes. S100A9 is located in myeloid cells, cancer cells, and in tumor stroma. S100A9 is an abundant cytoplasmic protein in normal myeloid cells such as polymorphonuclear cells and monocytes. It has become clear that S100A9 localizes with its partner S100A8 in many biological processes but may act as a sole player in other cancers. S100A8 and S100A9 are minimally expressed in normal esophageal epithelium, but S100A9 is expressed across the spectrum of Barrett’s esophagus through adenocarcinoma. S100A8 and S100A9 belong to a family of 25 homologous low-molecular-weight intracellular calcium-binding proteins that exhibit tissue and cell-specific expression. They are characterized by two distinct EF-hand (helix-loop-helix) calcium-binding domains connected by a hinge region. The N-terminal Ca 2+ binding domain has lower affinity than the canonical C-terminal domain that allows for functionally important second messenger roles dependent on intracellular Ca 2+ levels. These proteins have been associated with chronic inflammatory diseases such as rheumatoid arthritis (RA), cystic fibrosis, Crohns disease, ulcerative colitis, allergic dermatitis, and infection.