Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

S100P Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:S100 calcium-binding protein P, Protein S100-E, S100E
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD181048100 0.1 mg
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant Human S100P.

Amino Acid Sequence

Total 105 AA. MW: 11.64 kDa (calculated). N-Terminal His-tag (10 extra AA). UniprotKB acc.no. P25815

MKHHHHHHASMTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human S100P.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody

Note

This product is for research use only.

Summary

Research topic

Cardiovascular disease, Oncology, Reproduction

Summary

S100P was originally described as a placental protein of 95 amino acid residues shares about 50% sequence identity with the brain S100 proteins alpha and beta. S100 proteins are small dimeric members of the EF-hand superfamily of Ca(2+) binding proteins thought to participate in mediating intracellular Ca(2+) signals by binding to and thereby regulating target proteins in a Ca(2+)-dependent manner. S100P is dysregulated in the androgen-independent prostate cancer cell lines LNCaP-R, DU145, and PC3 and may play a role in the etiology of prostate cancer. In ductal hyperplasias, in situ and invasive ductal carcinoma, but not in the normal tissues, S100P overexpression is an early event that might play an important role in the imortalization of human breast epithelial cells in vitro and tumor progression in vivo. In NIH3T3 cells, the expression of S100P led to the presence of S100P in the culture medium, increased cellular proliferation, and enhanced survival following detachment from the culture substrate or after exposure to the chemotherapeutic agent 5-flurouracil. The proliferation and survival effects of S100P expression were duplicated in a time- and concentration-dependent manner by extracellular addition of purified S100P to wild-type NIH3T3 cells and correlated with the activation of Erks and NF- B. To determine the mechanisms involved in these effects, we tested the hypothesis that S100P activated RAGE (Receptor for Activated Glycation End-Products). It was found that S100P co-immunoprecipitated with RAGE. Furthermore, the effects of S100P on cell signaling, proliferation and survival were blocked by agents that interfere with RAGE including administration of an amphoterin derived peptide known to antagonize RAGE activation, anti-RAGE antibodies and by expression of a dominant negative RAGE. These data suggest that S100P can act in an autocrine manner via RAGE to stimulate cell proliferation and survival.

References to Summary

References to S100P

  • Arumugam T, Simeone DM, Schmidt AM, Logsdon CD. S100P stimulates cell proliferation and survival via receptor for activated glycation end products (RAGE). J Biol Chem. 2004 Feb 13;279 (7):5059-65
  • Arumugam T, Simeone DM, Van Golen K, Logsdon CD. S100P promotes pancreatic cancer growth, survival, and invasion. Clin Cancer Res. 2005 Aug 1;11 (15):5356-64
  • Barry S, Chelala C, Lines K, Sunamura M, Wang A, Marelli-Berg FM, Brennan C, Lemoine NR, Crnogorac-Jurcevic T. S100P is a metastasis-associated gene that facilitates transendothelial migration of pancreatic cancer cells. Clin Exp Metastasis. 2013 Mar;30 (3):251-64
  • Becker T, Gerke V, Kube E, Weber K. S100P, a novel Ca(2+)-binding protein from human placenta. cDNA cloning, recombinant protein expression and Ca2+ binding properties. Eur J Biochem. 1992 Jul 15;207 (2):541-7
  • Cai XY, Lu L, Wang YN, Jin C, Zhang RY, Zhang Q, Chen QJ, Shen WF. Association of increased S100B, S100A6 and S100P in serum levels with acute coronary syndrome and also with the severity of myocardial infarction in cardiac tissue of rat models with ischemia-reperfusion injury. Atherosclerosis. 2011 Aug;217 (2):536-42
  • Gribenko A, Lopez MM, Richardson JM 3rd, Makhatadze GI. Cloning, overexpression, purification, and spectroscopic characterization of human S100P. Protein Sci. 1998 Jan;7 (1):211-5
  • Guerreiro Da Silva ID, Hu YF, Russo IH, Ao X, Salicioni AM, Yang X, Russo J. S100P calcium-binding protein overexpression is associated with immortalization of human breast epithelial cells in vitro and early stages of breast cancer development in vivo. Int J Oncol. 2000 Feb;16 (2):231-40
  • Jin G, Wang S, Hu X, Jing Z, Chen J, Ying K, Xie Y, Mao Y. Characterization of the tissue-specific expression of the s100P gene which encodes an EF-hand Ca2+-binding protein. Mol Biol Rep. 2003 Dec;30 (4):243-8
  • Kim JK, Jung KH, Noh JH, Eun JW, Bae HJ, Xie HJ, Ahn YM, Ryu JC, Park WS, Lee JY, Nam SW. Targeted disruption of S100P suppresses tumor cell growth by down-regulation of cyclin D1 and CDK2 in human hepatocellular carcinoma. Int J Oncol. 2009 Dec;35 (6):1257-64
  • Maciejczyk A, Lacko A, Ekiert M, Jagoda E, Wysocka T, Matkowski R, Halon A, Gyorffy B, Lage H, Surowiak P. Elevated nuclear S100P expression is associated with poor survival in early breast cancer patients. Histol Histopathol. 2013 Apr;28 (4):513-24
  • Sato N, Hitomi J. S100P expression in human esophageal epithelial cells: Human esophageal epithelial cells sequentially produce different S100 proteins in the process of differentiation. Anat Rec. 2002 May 1;267 (1):60-9
  • Shyu RY, Huang SL, Jiang SY. Retinoic acid increases expression of the calcium-binding protein S100P in human gastric cancer cells. J Biomed Sci. 2003 May-Jun;10 (3):313-9
  • Truong LD, Shen SS. Immunohistochemical diagnosis of renal neoplasms. Arch Pathol Lab Med. 2011 Jan;135 (1):92-109
  • Wang Q, Zhang YN, Lin GL, Qiu HZ, Wu B, Wu HY, Zhao Y, Chen YJ, Lu CM. S100P, a potential novel prognostic marker in colorectal cancer. Oncol Rep. 2012 Jul;28 (1):303-10
  • Yuan RH, Chang KT, Chen YL, Hsu HC, Lee PH, Lai PL, Jeng YM. S100P expression is a novel prognostic factor in hepatocellular carcinoma and predicts survival in patients with high tumor stage or early recurrent tumors. PLoS One. 2013;8 (6):e65501
  • Zhang D, Ma C, Sun X, Xia H, Zhang W. S100P expression in response to sex steroids during the implantation window in human endometrium. Reprod Biol Endocrinol. 2012;10:106
Related Products Docs