Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

sCD23 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CD23 antigen, Fc-epsilon-RII, Lymphocyte IgE receptor, BLAST-2
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10097005 5 µg
RBG10097020 20 µg
RBG10097100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

CD23, the low affinity receptor for IgE, belongs to the C-type lectin structural family and plays a role in the regulation of IgE synthesis and IgE mediated activities. It is found both as a transmembrane receptor protein and in a soluble form, which is generated by proteolytic cleavage of membrane bound CD23. The predominant soluble form of CD23 (sCD23) consists of 172 amino acids corresponding to the extracellular domain of the full length precursor. sCD23, in addition to binding IgE, also exerts a number of IgE-independent activities, such as promoting the activation and differentiation of B-cells and stimulating the release of pro-inflammatory cytokines from monocytes. Recombinant Human sCD23 is a 19.2 kDa non-glycosylated protein containing 172 amino-acid residues.

Amino Acid Sequence

MELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Source

E. coli

Purity

96%

Biological Activity

Measured by its ability to induce TNF-α production by human PBMCs.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Immune Response, Infection and Inflammation

Related Products Docs