Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

SCGF-β Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Stem Cell Growth Factor-ß
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10293002 2 µg
RBG10293010 10 µg
RBG10293100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

SCGF-α and -β are hematopoietic growth factors that exert their activity at early stages of hematopoiesis. The SCGFs are non-glycosylated species-specific cytokines that can support growth of primitive hematopoietic cells, and, in combination with EPO or GM-CSF, promote proliferation of erythroid or myeloid progenitors, respectively. Recombinant Human SCGF-β is a 25.0 kDa polypeptide containing 227 amino acid residues.

Amino Acid Sequence

MGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF

Source

E. coli

Purity

98%

Biological Activity

Determined by its inhibitory effect on the proliferation of TF-1 cells previously grown in media containing GM-CSF. The ED50 for this effect was observed at ≤ 7 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Bone and cartilage metabolism

Related Products Docs