Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

SDF-1β Rat E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Stromal-Cell Derived Factor-1, CXCL12, PBSF
  • Species:Rat
Please select your region to see available products and prices.
Cat. No. Size Price


RBG30075002 2 µg
RBG30075010 10 µg
RBG30075100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

SDF-1α and β are stromal-derived, CXC chemokines that signal through the CXCR4 receptor. SDF-1α and β chemoattract B and T cells, and have been shown to induce migration of CD34+ stem cells. Additionally, the SDF-1 proteins exert HIV-suppressive activity in cells expressing the CXCR4 receptor. Human and murine SDF-1 proteins act across species. SDF-1α and β contain the four highly conserved cysteine residues present in CXC chemokines. The mature SDF-1β protein, produced by an N-terminal truncation of two additional amino acids, after removal of the signal sequence, contains 72 amino acid residues. Recombinant Rat SDF-1β is an 8.4 kDa protein containing 72 amino acid residues.

Amino Acid Sequence

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNKRLKM

Source

E. coli

Purity

95%

Biological Activity

Determined by its ability to chemoattract human monocytes using a concentration range of 100.0–200.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation, Neural tissue markers, Animal studies

Related Products Docs