Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Secretagogin Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:SCGN, SECRET
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172120100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 286 AA. MW: 33.3 kDa (calculated). N-terminal His-tag, 10exrea AA (highlighted). The AA sequence is identical to UniProtKB/Swiss-Prot entry O76038.

Amino Acid Sequence

MKHHHHHHASMDSSREPTLGRLDAAGFWQVWRRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 95%

SDS-PAGE Gel

12% SDS-PAGE separation of Human SCGN
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml in 20mM Tris buffer, 20mM NaCl, pH 7.5

Reconstitution

Add 200ul of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Neural tissue markers, Oncology

Summary References (8)

References to Secretagogin

  • Adolf K, Wagner L, Bergh A, Stattin P, Ottosen P, Borre M, Birkenkamp-Demtroder K, Orntoft TF, Torring N. Secretagogin is a new neuroendocrine marker in the human prostate. Prostate. 2007 Apr 1;67 (5):472-84
  • Gartner W, Lang W, Leutmetzer F, Domanovits H, Waldhausl W, Wagner L. Cerebral expression and serum detectability of secretagogin, a recently cloned EF-hand Ca(2+)-binding protein. Cereb Cortex. 2001 Dec;11 (12):1161-9
  • Gartner W, Vila G, Daneva T, Nabokikh A, Koc-Saral F, Ilhan A, Majdic O, Luger A, Wagner L. New functional aspects of the neuroendocrine marker secretagogin based on the characterization of its rat homolog. Am J Physiol Endocrinol Metab. 2007 Jul;293 (1):E347-54
  • Gartner W, Zierhut B, Mineva I, Sodeck G, Leutmezer F, Domanovits H, Prayer D, Wolf F, Base W, Weissel M, Wagner L. Brain natriuretic peptide correlates with the extent of atrial fibrillation-associated silent brain lesions. Clin Biochem. 2008 Dec;41 (18):1434-9
  • Lai M, Lu B, Xing X, Xu E, Ren G, Huang Q. Secretagogin, a novel neuroendocrine marker, has a distinct expression pattern from chromogranin A. Virchows Arch. 2006 Oct;449 (4):402-9
  • Pipp I, Wagner L, Rossler K, Budka H, Preusser M. Secretagogin expression in tumours of the human brain and its coverings. APMIS. 2007 Apr;115 (4):319-26
  • Rogstam A, Linse S, Lindqvist A, James P, Wagner L, Berggard T. Binding of calcium ions and SNAP-25 to the hexa EF-hand protein secretagogin. Biochem J. 2007 Jan 1;401 (1):353-63
  • Wagner L, Oliyarnyk O, Gartner W, Nowotny P, Groeger M, Kaserer K, Waldhausl W, Pasternack MS. Cloning and expression of secretagogin, a novel neuroendocrine- and pancreatic islet of Langerhans-specific Ca2+-binding protein. J Biol Chem. 2000 Aug 11;275 (32):24740-51
Related Products Docs