Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

SF-20 Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL-25
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20122002 2 µg
RBG20122010 10 µg
RBG20122100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Murine SF20 is a bone marrow stroma-derived growth factor. SF20 is expressed in bone marrow, spleen stroma cells, resting mononuclear cells, resting CD8+ and CD19+ cells, and activated CD8+ T cells, and has been shown to bind to the surface of cells expressing the receptor TSA-1 (Thymic shared Ag-1). Among its biological activities, SF20 stimulates the proliferation of FDCP2 cells (a mouse factor-dependent hemopoietic cell line) and mouse lymphoid cells. Recombinant Murine SF20 is a 15.8 kDa protein containing 143 amino acid residues.

Amino Acid Sequence

MVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL

Source

E. coli

Purity

98%

Biological Activity

Data not available.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Immune Response, Infection and Inflammation, Animal studies

Related Products Docs