Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

sFRP-1 Human HeLa cells

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HeLa cells
  • Other names:Soluble Frizzled Related Protein-1, Secreted Apoptosis Related Protein-2, SARP-2
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10150005 5 µg
RBG10150020 20 µg
RBG10150100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Secreted Frizzled Related Proteins (sFRPs) modulate WNT signaling by binding directly to WNT proteins in a manner that affects their receptor binding and signaling capabilities. sFRP-1 is a widely distributed protein that can bind directly to WNT1, WNT2, and possibly other WNT proteins, and generally exerts anti-proliferative effects consistent with activity as a WNT antagonist. It also inhibits apoptosis, and has been found to be down-regulated in many solid tumors, but up-regulated in uterine leiomyomas. Recombinant Human sFRP-1 is a glycosylated 283 amino acid protein containing a cysteine-rich Frizzled homologous domain. The calculated molecular weight of Recombinant Human sFRP-1 is 32.5 kDa.

Amino Acid Sequence

SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

Source

HeLa cells

Purity

97%

Biological Activity

Determined by its ability to inhibit BMP-2 proliferation effect of ATDC-5 cells. The expected ED50 is 0.3–0.5 µg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Cardiovascular disease, Coronary artery disease, Oncology

Related Products Docs