Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

sFRP4 Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293
  • Other names:Secreted Frizzled-Related Protein 4
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172132100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 341 AA, UniProt Q6FHJ7 (Val19-Val346). MW: 39.0 kDa (calculated), migrates at ~ 55 kDa on SDS PAGE; two N-terminal linkers (2 extra AA and 3 extra AA highlighted), N-terminal Flag-tag (8 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

PGDYKDDDDKPAGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV

Source

HEK293

Purity

Purity as determined by densitometric image analysis: >95%

SDS-PAGE Gel

12% SDS-PAGE separation of Human sFRP4
1. M.W. marker – 97, 66, 45, 31, 21, 14 kDa
2. reduced and boiled sample, 2.5μg / lane
3. non-reduced and non-boiled sample, 2.5μg / lane

Endotoxin

<0.1 EU/µg

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4

Reconstitution

Add 200ul of deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Applications

Western blotting, ELISA, Cell culture and/or animal studies

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Summary

Research topic

Diabetology - Other Relevant Products

Summary

sFRP-4 is a cystein-rich glycoprotein that belongs to the group of G protein-coupled receptor proteins. It is expressed in proliferative endometrium and several types of ovarian, endometrial and brest tumors. It is up-regulated in failing myocardium.

Related Products Documents