Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

sInterleukin-2 Receptor α Human CHO cells

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:CHO cells
  • Other names:IL-2R, Interleukin-2 receptor alpha, CD25 antigen
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RBG10002S0025 25 µg
New RBG10002S0100 100 µg
New RBG10002S1000 1.0 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

The IL-2 receptor system consists of three non-covalently linked subunits termed IL-2Rα, IL-2Rβ, and IL-2Rγ. The IL-2Rα is a type I transmembrane protein consisting of a 219 amino acid extracellular domain, a 19 amino acid transmembrane domain and a 13 amino acid intracellular domain, which is not involved in the transduction of IL-2 signals. Proteolytic processing of IL-2Rα releases the entire extracellular domain of IL-2Rα, thereby generating a 219 amino acid soluble protein called soluble IL-2Rα (sIL-2Rα). The homodimeric form binds IL-2 (KD=10mM) and facilitates IL-2 signaling. The secreted sIL-2Rα is expressed on leukemia cells, lymphoma cells, and newly activated T and B cells, as well as on approximately 10% of NK cells.-- Recombinant Human sIL-2 Receptor α is a 24.8 kDa protein containing 219 amino acid residues consisting of only the extracellular domain of IL-2Rα. As a result of glycosylation, Recombinant Human sIL-2 Receptor α migrates with an apparent molecular mass of approximately 40-50 kDa by SDS-PAGE gel, under reducing and non-reducing conditions.

Amino Acid Sequence

ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQS PMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESET SCLVTTTDFQIQTEMAATMETSIFTTEYQ

Source

CHO cells

Purity

≥ 98% by SDS-PAGE gel and HPLC analyses.

Biological Activity

Determined by its ability to increase the proliferation effect of IL-2 in mouse CTLL-2 cells. In the presence of 1 ng/ml of recombinant IL-2, the expected-ED50-for this effect is between 0.5-1.5 μg/ml.

Endotoxin

< 1.0 EU/μg

Formulation

Sterile filtered through a 0.2 micron filter. Lyophilized from 20mM Sodium Citrate, pH 3.0.

Reconstitution

Centrifuge vial prior to opening. Reconstitute in water to 0.1-1.0 mg/ml. Do not vortex. Store at 2°C to 8°C for 1 week, or prepare for extended storage.

Note

This product is intended for research use only.

Summary

Research topic

Cytokines and chemokines and related molecules, Oncology

Summary

The receptor of the cytokine IL-2 plays a crucial role in the regulation of the immune response. Binding of IL-2 to its receptor (IL-2R) on the surface of T-lymphocytes triggers a series of intracellular signaling events that result in the activation and proliferation of resting T cells and in the generation of helper, suppressor and cytotoxic T cells, which mediate immune reactions. sIL-2R is a marker for T cell activation. It can be an indicator of a wide spectrum of disorders involving immune activation. IL2R can be found at significantly elevated levels in a broad range of disorders such as tumor diseases, autoimmune diseases (e.g. sarcoidosis), organ rejection and various infections.

Related Products Docs