Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

SPARC/Osteonectin Human Chinese Hamster Ovary Cells (CHO)

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:Chinese Hamster Ovary Cells (CHO)
  • Other names:Secreted protein acidic and rich in cysteine, BM-40, ON
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10301010 10 µg
RBG10301050 50 µg
RBG10301100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

SPARC/Osteonectin is a secreted, evolutionarily-conserved, collagen-binding glycoprotein that is involved in a variety of cellular activities. It is highly expressed in tissues undergoing morphogenesis, remodeling and wound repair. SPARC/Osteonectin and its related peptides bind to numerous proteins of the extracellular matrix (ECM), affect ECM protein expression, influence cellular adhesion and migration, and modulate growth factor-induced cell proliferation and angiogenesis. SPARC/Osteonectin consists of three domains: an N-terminal acidic region that binds calcium ions with low affinity, a module containing two EF-hand motifs that bind calcium with high affinity, and a cysteine-rich follistatin-like domain. Recombinant Human SPARC/Osteonectin is a glycoprotein containing 286 amino acids that migrates at an apparent MW of 43.7 kDa by SDS-PAGE analysis due to the effect of glycosylation. The calculated molecular weight of Recombinant Human SPARC/Osteonectin is 32.7 kDa.

Amino Acid Sequence

APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Source

Chinese Hamster Ovary Cells (CHO)

Purity

98%

Biological Activity

Determined by its ability to increase alkaline phosphatase activity in differentiating MC3T3 cells using a concentration of 0.5–0.7 µg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Bone and cartilage metabolism, Cardiovascular disease, Coronary artery disease, Oncology

Related Products Docs