Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

sPLA2-IID Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Group IID secretory phospholipase A2, GIID sPLA2, PLA2IID, Phosphatidylcholine 2-acylhydrolase 2D, Secretory-type PLA, stroma-associated homolog, PLA2G2D, SPLASH
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172067100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 141 AA. MW: 16.4 kDa (calculated). UniProtKB acc.no. Q9UNK4. N-Terminal His-tag, 16 extra AA (highlighted).

Amino Acid Sequence

MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCGIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC

Source

E. coli

Purity

>95%

SDS-PAGE Gel

12% SDS-PAGE separation of Human sPLA2-IID
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and frozen from 0.3–0.8 mg/mL solution in 0.03M Acetate buffer pH=4.0 containing 20% (w/v) glycerol.

Reconstitution

Defrost at ambient temperature. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store protein at –80°C. Protein remains stable until the expiry date when stored at –80°C. Avoid repeated freezing/thawing cycles. The thawed protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Related Products Docs