Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

sPLA2-V Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Calcium-dependent phospholipase A2, Group V phospholipase A2, PLA2-10, Phosphatidylcholine 2-acylhydrolase 5, PLA2G5
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172081100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 134 AA. MW: 15.5 kDa (calculated). UniProtKB acc.no. P39877. N-Terminal His-tag, 16 extra AA (highlighted).

Amino Acid Sequence

MRGSHHHHHHGMASHMGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS

Source

E. coli

Purity

>95%

SDS-PAGE Gel

12% SDS-PAGE separation of Human sPLA2-V 1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05M Acetate buffer pH=4.0

Reconstitution

Add 0.1M Acetate buffer pH4 to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/mL. In higher concentrations the solubility of this antigen is limited. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at -80 °C. Lyophilized protein remains stable until the expiry date when stored at -80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Product References (2)

References

  • Tanabe T, Shimokawaji T, Kanoh S, Rubin BK. Secretory phospholipases A2 are secreted from ciliated cells and increase mucin and eicosanoid secretion from goblet cells. Chest. 2015 Jun;147(6):1599-1609. doi: 10.1378/chest.14-0258. PubMed PMID: 25429648. PubMed CentralPMCID: PMC4451714. See more on PubMed
  • Rönkkö S, Rekonen P, Kaarniranta K, Puustjarvi T, Teräsvirta M, Uusitalo H. Phospholipase A2 in chamber angle of normal eyes and patients with primary open angle glaucoma and exfoliation glaucoma. Mol Vis. 2007 Mar 26;13:408-17. PubMed PMID: 17417602. PubMed CentralPMCID: PMC2642936. See more on PubMed
Related Products Docs